Clone RE26382 Report

Search the DGRC for RE26382

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:263
Well:82
Vector:pFlc-1
Associated Gene/TranscriptRpL18A-RA
Protein status:RE26382.pep: gold
Preliminary Size:660
Sequenced Size:686

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6510 2001-12-17 Blastp of sequenced clone
CG6510 2002-01-01 Sim4 clustering to Release 2
RpL18A 2008-04-29 Release 5.5 accounting
RpL18A 2008-08-15 Release 5.9 accounting
RpL18A 2008-12-18 5.12 accounting

Clone Sequence Records

RE26382.complete Sequence

686 bp (686 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071222

> RE26382.complete
GAATCGAGGTTCAGTGTCATACCGATTTGACAAGCTCTTTCCGTTTCCTT
TTCGCGTGAACGTCCAACATGAGAGCCAAGGGATTGTTGAAGGAGTACGA
GGTCGTGGGCCGCAAGCTGCCCAGCGAGAAGGAGCCCCAGACTCCCCTCT
ACAAGATGCGCATCTTTGCCCCCGACAACATCGTGGCCAAATCCCGCTTC
TGGTACTTCCTGCGCCAACTGAAGAAGTTCAAGAAGACCACCGGCGAGAT
CGTGTCCATCAAGCAGGTGTACGAGACGTCGCCCGTGAAGATCAAGAACT
TCGGCATCTGGCTGCGTTACGATTCCCGCTCGGGCACCCACAACATGTAC
CGCGAGTACCGTGACCTGACTGTCGGCGGTGCCGTCACTCAGTGCTACCG
CGACATGGGAGCCCGCCACCGTGCCCGTGCCCACTCCATCCAGATCATTA
AGGTGGACTCGATCCCTGCCGCCAAGACCCGCCGCGTGCACGTGAAGCAG
TTCCACGATTCAAAGATCAAGTTCCCTCTGGTCCAGCGTGTCCACCACAA
GGGCAACAGGAAACTGTTCTCGTTCAGGAAGCCCAGGACCTACTTCCAGT
AGGATTCTCCTGCATCCTATACCTATGACTTAGTGGATTTTTTCAATAAA
TGAGAACGTTGAAGAGTAAAAAAAAAAAAAAAAAAA

RE26382.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18A-RA 683 RpL18A-RA 1..668 1..668 3340 100 Plus
cyp33-RA 1482 cyp33-RA 1446..1482 668..632 185 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13433458..13434039 667..86 2895 99.8 Minus
chr2R 21145070 chr2R 13434473..13434558 86..1 430 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17546405..17546987 668..86 2915 100 Minus
2R 25286936 2R 17547409..17547494 86..1 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17547604..17548186 668..86 2915 100 Minus
2R 25260384 2R 17548608..17548693 86..1 430 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:41:11 has no hits.

RE26382.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:42:12 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13433458..13434038 87..667 99 <- Minus
chr2R 13434473..13434558 1..86 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:25 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..534 69..602 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:59 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..534 69..602 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:24:53 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..534 69..602 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:38 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..534 69..602 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:40 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..534 69..602 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:44 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..667 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:59 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..667 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:24:53 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..635 33..667 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:38 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..667 1..667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:40 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18A-RA 1..635 33..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:12 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17546406..17546986 87..667 100 <- Minus
2R 17547409..17547494 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:12 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17546406..17546986 87..667 100 <- Minus
2R 17547409..17547494 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:12 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17546406..17546986 87..667 100 <- Minus
2R 17547409..17547494 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:24:53 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13433911..13434491 87..667 100 <- Minus
arm_2R 13434914..13434999 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:59 Download gff for RE26382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17547605..17548185 87..667 100 <- Minus
2R 17548608..17548693 1..86 100   Minus

RE26382.hyp Sequence

Translation from 68 to 601

> RE26382.hyp
MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQ
LKKFKKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDL
TVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKI
KFPLVQRVHHKGNRKLFSFRKPRTYFQ*

RE26382.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18A-PA 177 CG6510-PA 1..177 1..177 932 100 Plus

RE26382.pep Sequence

Translation from 68 to 601

> RE26382.pep
MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQ
LKKFKKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDL
TVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKI
KFPLVQRVHHKGNRKLFSFRKPRTYFQ*

RE26382.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13512-PA 177 GF13512-PA 1..177 1..177 931 97.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21044-PA 177 GG21044-PA 1..177 1..177 942 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20961-PA 177 GH20961-PA 1..177 1..177 920 96.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18A-PA 177 CG6510-PA 1..177 1..177 932 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21298-PA 177 GI21298-PA 1..177 1..177 928 97.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10622-PA 177 GL10622-PA 1..177 1..177 930 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19650-PA 177 GA19650-PA 1..177 1..177 930 98.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19972-PA 177 GM19972-PA 1..177 1..177 942 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25466-PA 177 GD25466-PA 1..177 1..177 942 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20900-PA 177 GJ20900-PA 1..177 1..177 928 97.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21403-PA 177 GK21403-PA 1..177 1..177 932 97.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL18A-PA 177 GE13987-PA 1..177 1..177 942 100 Plus