BDGP Sequence Production Resources |
Search the DGRC for RE26473
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 264 |
Well: | 73 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG15382-RA |
Protein status: | RE26473.pep: gold |
Preliminary Size: | 474 |
Sequenced Size: | 1046 |
Gene | Date | Evidence |
---|---|---|
CG15382 | 2001-12-14 | Blastp of sequenced clone |
CG15382 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15382 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15382 | 2008-04-29 | Release 5.5 accounting |
CG15382 | 2008-08-15 | Release 5.9 accounting |
CG15382 | 2008-12-18 | 5.12 accounting |
1046 bp (1046 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071223
> RE26473.complete AGTTCCTTCTCGACAGTCTAATCATGAAGTACCGCATGTTGAATAAACGC AAACAGGCGACTCCCTCGCCAGTAAGAGATTCCGACGCAGCCGACGTAGC CATGGCCAACCACAGTGCTCTGGAACTGGAGGCGGCTGCGGCTCTCTTGT TGCTCCGCTACCAATACGATCGACAAGTGTGCAATAACATTATAACCTAC ACGGAGTCCTGTTCCCCGACTCCACCGCCGGCAGTTGCTGACAACACGAC GCCAAAAGATCAGACTGTTCGTCCGCCAGTCGCCAGCCAGCCGCTGAAGA AGCGCTCCATACCATCGCACATCCTCCGCAGATCCCTGACTCCGGCCAAA TCCGAGACTTCAGTGAGCAACAAGTCGATAGTCAAGGCCAAGACGAGGAC TCCAATTCCCAGTAAGGAGCGAAACTGCAACAGGACCTTGCTTAAGTCCT GCAGAAATATGATTCGAGAGTTTTTGGACAATCAGGAGTTTATCTAAAAA AAAAAGTTTAACTATGTATCCTAGGATAACCGCCTGAAACCAATTCTACA TTTGTAATTTTACACAAATCAAGATTTTAGAAATCTTCGCAAAAAACGCC ACAGTGAATTGCACGATTGCAGAAAAGATCGAAACGAAATCCTTAAACAA ATGTAGCCCAGTATATAACAGTCCCGAGAAAGATGAAGGCGATCGATCCT TGGGATCTTGGATTTCAGTTTTCAATTTATTTATTGCATATAAATTTGTT TCCTTTTTTATACATATATAAATTATGTATTGATCGAAAGATAACGTTTT CAATGGAAGAACAGGTATTGTGGCGACACTAGAGTGCTAATTATTAGCTA TTGGCGGTGTTTAAACTTAAGGCGTACGAAAAACAAATAGAAAATTAACT TTAGCGTAGATCTACACAATAATTAATAATTACAGTTGCACTACAGGCTA ATTGTATGAACGTGCAGCGATGATATCTTCTCCTAACTCTGTTCATTCCG TTTAATGTAATTAATAAAGTGCTTCAAATGTAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 2155491..2156521 | 1..1031 | 5080 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 2155760..2156791 | 1..1032 | 5160 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 2155760..2156791 | 1..1032 | 5160 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader3 | 5484 | invader3 INVADER3 5484bp | 5078..5157 | 785..704 | 135 | 67.9 | Minus |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 6495..6569 | 783..709 | 131 | 67.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 2155491..2156521 | 1..1031 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..474 | 24..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..474 | 24..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..474 | 24..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..474 | 24..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..474 | 24..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..1031 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..1031 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 8..1038 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 1..1031 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15382-RA | 8..1038 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2155760..2156790 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2155760..2156790 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2155760..2156790 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 2155760..2156790 | 1..1031 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2155760..2156790 | 1..1031 | 100 | Plus |
Translation from 2 to 496
> RE26473.hyp FLLDSLIMKYRMLNKRKQATPSPVRDSDAADVAMANHSALELEAAAALLL LRYQYDRQVCNNIITYTESCSPTPPPAVADNTTPKDQTVRPPVASQPLKK RSIPSHILRRSLTPAKSETSVSNKSIVKAKTRTPIPSKERNCNRTLLKSC RNMIREFLDNQEFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15382-PA | 157 | CG15382-PA | 1..157 | 8..164 | 803 | 100 | Plus |
Translation from 23 to 496
> RE26473.pep MKYRMLNKRKQATPSPVRDSDAADVAMANHSALELEAAAALLLLRYQYDR QVCNNIITYTESCSPTPPPAVADNTTPKDQTVRPPVASQPLKKRSIPSHI LRRSLTPAKSETSVSNKSIVKAKTRTPIPSKERNCNRTLLKSCRNMIREF LDNQEFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14604-PA | 157 | GF14604-PA | 1..157 | 1..157 | 578 | 76.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24833-PA | 157 | GG24833-PA | 1..157 | 1..157 | 698 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10277-PA | 202 | GH10277-PA | 38..202 | 45..157 | 175 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15382-PA | 157 | CG15382-PA | 1..157 | 1..157 | 803 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15746-PA | 178 | GI15746-PA | 1..178 | 1..157 | 191 | 41.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18706-PA | 166 | GL18706-PA | 1..166 | 1..157 | 359 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13689-PA | 166 | GA13689-PA | 1..166 | 1..157 | 360 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23740-PA | 157 | GM23740-PA | 1..157 | 1..157 | 796 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23135-PA | 157 | GD23135-PA | 1..157 | 1..157 | 716 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10220-PA | 148 | GJ10220-PA | 36..148 | 45..157 | 226 | 53 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14999-PA | 216 | GK14999-PA | 115..216 | 71..157 | 277 | 59.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17965-PA | 157 | GE17965-PA | 1..157 | 1..157 | 708 | 94.9 | Plus |