Clone RE26879 Report

Search the DGRC for RE26879

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:268
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCpr56F-RA
Protein status:RE26879.pep: gold
Preliminary Size:741
Sequenced Size:1278

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9036 2001-12-14 Blastp of sequenced clone
CG9036 2002-01-01 Sim4 clustering to Release 2
CG9036 2003-01-01 Sim4 clustering to Release 3
Cpr56F 2008-04-29 Release 5.5 accounting
Cpr56F 2008-08-15 Release 5.9 accounting
Cpr56F 2008-12-18 5.12 accounting

Clone Sequence Records

RE26879.complete Sequence

1278 bp (1278 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071231

> RE26879.complete
CGATCACAATCAAGTCAACCATCTTCGCAAGAAGAACACAGCCAACAGAG
CAAAGTTAACAAAAACCGTTTTCGTGTGTGCCAAAATCCCAAACAAGTGA
CAACACAAAATGAAGGCTTTTACATCCATTGCCCTGCTCGTGTGCCTGGC
TGCCTGGACCCATGCGGAACCACCAGTTCCCCAGAACCAGTACCTGCCCC
CCAATCAGTCGCCTCAGGCGCCGTCCAACAACTACCTGCCGCCCACGCAG
GGCTACCAGTCGCCGTCGAGCAACTACTTGCCACCCCAGCGGGCCGGTGG
CAATGGAGGAGCGCCCAGCAACAGCTATGGCGCCCCCATCGCTCCTCCCC
AGGGTCAATATGGTGCTCCAGCGCTGACTGGTGCCATCTTCAAGGGCGGA
AACGGAAACGGAAACGGCGGCTATGGCGGCGGTAATGGCAACGGCAACGG
CTACGGACAACGGGATGAGGAGCAGTATGGACCGGCCAAGTACGAGTTCA
AGTACGACGTACAGGACTACGAGTCGGGCAATGACTTCGGCCACATGGAG
TCCCGCGATGGTGATCTTGCTGTGGGCCGCTACTACGTCCTGCTGCCCGA
TGGACGCAAACAGATTGTTGAGTACGAGGCCGACCAGAATGGATACCGCC
CAACCATTCGGTACGAGCAGGTCGGCAATGGCAACGGAAACGGCAATGGC
AATGGTCGCAACGGTGGCGGTTATGATAGCAACGCGCAGCAGGGCAAATT
CAACGGCTACTAAGATGGGGAAGTGAGGATACCCGATTTAGGTCGACCCC
GCAACTATACTCGTCTACTTCATGGGATCGCTGGCCGAGTATTAAACGCA
CATCCAGCCAGTGGGCCAGCGATCGCAGTCAGTCTATCCATATAACCCTA
TTCCCATCTCTGTGCATACCCTTAGTGGGACGCCCGCCATTTTGCCATAG
ACAGGCGCGTTCCTTTCCGTTTCCGTTTCACTGCTGTTCGTTATCCTGTT
TTCCGTCTCTACACCTGGAACTCCTTGCCGTTTTGTTTTGTTTAAGCGCC
TTCATTTTGTGTTAGTCTACGCACACACTCCAACACACCATTCACCCACA
ACATGACCATTACGCATTCATACATACATGCATAAGGATTGTATTTAGTT
TTTAAACGAAAATGGAAATTCGAAAGTGAAACGAACTTATGAGATTTTTG
TGTATATTTAATAATTATTAAATGAATAAAGAAGCATTTTTGTATAAAAC
AAAGTCAAAAAGGAAAAAAAAAAAAAAA

RE26879.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr56F-RA 1303 Cpr56F-RA 34..1298 3..1267 6310 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16175399..16176547 1262..114 5745 100 Minus
chr2R 21145070 chr2R 16178858..16178971 116..3 570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20288360..20289513 1267..114 5755 99.9 Minus
2R 25286936 2R 20291827..20291940 116..3 570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20289559..20290712 1267..114 5755 99.9 Minus
2R 25260384 2R 20293026..20293139 116..3 570 100 Minus
Blast to na_te.dros performed 2019-03-16 03:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6858..6904 1245..1198 111 72.9 Minus

RE26879.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:19:52 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16175398..16176545 116..1263 98 <- Minus
chr2R 16178859..16178971 1..115 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:53 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 1..654 110..763 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:53 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 1..654 110..763 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:17 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 1..654 110..763 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:21 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 1..654 110..763 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:15 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 1..654 110..763 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:35:22 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:53 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:17 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 2..1259 1..1256 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:21 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:15 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr56F-RA 2..1259 1..1256 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:52 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20288364..20289511 116..1263 99 <- Minus
2R 20291828..20291940 1..115 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:52 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20288364..20289511 116..1263 99 <- Minus
2R 20291828..20291940 1..115 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:52 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20288364..20289511 116..1263 99 <- Minus
2R 20291828..20291940 1..115 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:17 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16175869..16177016 116..1263 99 <- Minus
arm_2R 16179333..16179445 1..115 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:53 Download gff for RE26879.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20289563..20290710 116..1263 99 <- Minus
2R 20293027..20293139 1..115 98   Minus

RE26879.hyp Sequence

Translation from 109 to 762

> RE26879.hyp
MKAFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQ
SPSSNYLPPQRAGGNGGAPSNSYGAPIAPPQGQYGAPALTGAIFKGGNGN
GNGGYGGGNGNGNGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMESRD
GDLAVGRYYVLLPDGRKQIVEYEADQNGYRPTIRYEQVGNGNGNGNGNGR
NGGGYDSNAQQGKFNGY*

RE26879.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr56F-PA 217 CG9036-PA 1..217 1..217 1206 100 Plus
resilin-PA 620 CG15920-PA 248..459 24..217 397 44.7 Plus
resilin-PB 575 CG15920-PB 214..414 24..217 213 35.1 Plus
resilin-PA 620 CG15920-PA 7..264 7..216 208 32.7 Plus
resilin-PB 575 CG15920-PB 7..264 7..216 208 32.7 Plus
Cpr50Cb-PA 178 CG6305-PA 5..175 2..203 202 30.8 Plus
Cpr65Az-PA 239 CG12330-PA 31..187 14..181 183 28.8 Plus
resilin-PA 620 CG15920-PA 183..345 38..214 159 31.6 Plus

RE26879.pep Sequence

Translation from 109 to 762

> RE26879.pep
MKAFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQ
SPSSNYLPPQRAGGNGGAPSNSYGAPIAPPQGQYGAPALTGAIFKGGNGN
GNGGYGGGNGNGNGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMESRD
GDLAVGRYYVLLPDGRKQIVEYEADQNGYRPTIRYEQVGNGNGNGNGNGR
NGGGYDSNAQQGKFNGY*

RE26879.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12672-PA 213 GF12672-PA 1..213 1..217 861 88.9 Plus
Dana\GF11408-PA 587 GF11408-PA 317..378 125..186 242 74.2 Plus
Dana\GF13710-PA 174 GF13710-PA 89..148 128..186 158 51.7 Plus
Dana\GF13709-PA 856 GF13709-PA 790..851 126..186 147 45.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20868-PA 217 GG20868-PA 1..217 1..217 1056 96.8 Plus
Dere\GG20628-PA 619 GG20628-PA 342..403 125..186 243 74.2 Plus
Dere\GG20401-PA 181 GG20401-PA 90..149 128..186 159 51.7 Plus
Dere\GG20400-PA 810 GG20400-PA 726..805 111..186 157 42 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20062-PA 75 GH20062-PA 1..74 146..217 265 89.2 Plus
Dgri\GH23088-PA 605 GH23088-PA 310..371 125..186 243 74.2 Plus
Dgri\GH21033-PA 173 GH21033-PA 87..146 128..186 158 50 Plus
Dgri\GH21032-PA 798 GH21032-PA 719..792 113..186 152 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr56F-PA 217 CG9036-PA 1..217 1..217 1206 100 Plus
resilin-PA 620 CG15920-PA 248..459 24..217 397 44.7 Plus
resilin-PB 575 CG15920-PB 214..414 24..217 213 35.1 Plus
resilin-PA 620 CG15920-PA 7..264 7..216 208 32.7 Plus
resilin-PB 575 CG15920-PB 7..264 7..216 208 32.7 Plus
Cpr50Cb-PA 178 CG6305-PA 5..175 2..203 202 30.8 Plus
Cpr65Az-PA 239 CG12330-PA 31..187 14..181 183 28.8 Plus
Cpr50Ca-PA 815 CG13338-PA 731..810 111..186 165 42.5 Plus
resilin-PA 620 CG15920-PA 183..345 38..214 159 31.6 Plus
Muc91C-PB 949 CG7709-PB 745..895 24..148 151 29.6 Plus
Muc91C-PA 950 CG7709-PA 746..896 24..148 151 29.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18779-PA 206 GI18779-PA 1..205 9..217 730 88.1 Plus
Dmoj\GI21153-PA 589 GI21153-PA 296..366 125..199 216 65.3 Plus
Dmoj\GI18634-PA 173 GI18634-PA 29..146 39..186 158 35.5 Plus
Dmoj\GI18633-PA 785 GI18633-PA 695..779 108..186 154 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16837-PA 227 GL16837-PA 4..227 1..217 1024 92.9 Plus
Dper\GL11800-PA 621 GL11800-PA 226..374 52..190 246 48.1 Plus
Dper\GL17473-PA 176 GL17473-PA 89..148 128..186 161 51.7 Plus
Dper\GL17472-PA 847 GL17472-PA 761..842 107..186 150 42.2 Plus
Dper\GL15387-PA 536 GL15387-PA 46..125 97..175 145 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21496-PB 227 GA21496-PB 2..227 1..217 833 91.6 Plus
Dpse\GA24081-PA 621 GA24081-PA 188..372 52..190 237 43.2 Plus
Dpse\GA19503-PA 176 GA19503-PA 89..148 128..186 161 51.7 Plus
Dpse\GA12217-PA 841 GA12217-PA 755..836 107..186 154 42.2 Plus
Dpse\GA26062-PA 529 GA26062-PA 46..125 97..175 145 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19793-PA 201 GM19793-PA 1..201 1..217 963 91.7 Plus
Dsec\GM21722-PA 623 GM21722-PA 248..403 52..186 261 47.9 Plus
Dsec\GM21489-PA 178 GM21489-PA 90..149 128..186 158 51.7 Plus
Dsec\GM21488-PA 813 GM21488-PA 729..808 111..186 157 42 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25285-PA 215 GD25285-PA 1..215 1..217 1068 98.2 Plus
Dsim\GD11218-PA 609 GD11218-PA 252..389 38..186 253 51 Plus
Dsim\GD10983-PA 178 GD10983-PA 90..149 128..186 159 51.7 Plus
Dsim\GD10982-PA 826 GD10982-PA 742..821 111..186 156 42 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21806-PA 229 GJ21806-PA 14..228 2..217 807 88.9 Plus
Dvir\GJ21001-PA 633 GJ21001-PA 355..416 125..186 240 72.6 Plus
Dvir\GJ21646-PA 174 GJ21646-PA 88..147 128..186 156 50 Plus
Dvir\GJ21645-PA 793 GJ21645-PA 707..787 108..186 153 41.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19531-PA 134 GK19531-PA 3..133 81..217 444 79 Plus
Dwil\GK15914-PA 605 GK15914-PA 338..399 125..186 241 74.2 Plus
Dwil\GK17855-PA 176 GK17855-PA 90..149 128..186 157 50 Plus
Dwil\GK17854-PA 842 GK17854-PA 773..838 121..186 148 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13808-PA 215 GE13808-PA 1..215 1..217 1057 97.2 Plus
Dyak\GE11818-PA 622 GE11818-PA 334..395 125..186 241 74.2 Plus
Dyak\GE12561-PA 180 GE12561-PA 90..149 128..186 159 51.7 Plus
Dyak\GE12560-PA 814 GE12560-PA 728..809 107..186 158 42.2 Plus