Clone RE26983 Report

Search the DGRC for RE26983

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:269
Well:83
Vector:pFlc-1
Associated Gene/TranscriptPsf2-RB
Protein status:RE26983.pep: gold
Preliminary Size:612
Sequenced Size:825

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18013 2001-12-14 Blastp of sequenced clone
CG18013 2002-01-01 Sim4 clustering to Release 2
CG18013 2003-01-01 Sim4 clustering to Release 3
Psf2 2008-04-29 Release 5.5 accounting
Psf2 2008-08-15 Release 5.9 accounting
Psf2 2008-12-18 5.12 accounting

Clone Sequence Records

RE26983.complete Sequence

825 bp (825 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071234

> RE26983.complete
GGATGTTCCCGCATTTGTTTTGTTTGTTTATAGCAATTATGGATCCTTCA
ATTATTGAATTTATTGGCGAAAAATGCATGATCAGCATAATACCGAACTT
CAGCAACGAGCCTCTGCACCTGATATACGGACCTGTGGGCCCTTTCCGAG
CCGGTTTTCCCGTCTTCGTGCCCCTGTGGATGGCCACGCATCTGCGCAAG
CAACAAAAGTGCCGAATTGTACCTCCAGAATGGATGGACATGGATATATT
GGAGGAAATCAAGGAGGAGGAAAAGCGCTCAAAGTTCTTTACCAAAATGC
CCTGTGAGCATTACATGGTAGTGGCCCAGTTGGTCATGAGCACGGCTCCG
GATGACGTTCCGCGTTGCGAGGAGCTGCGCACTGTGATCAAGGACATCTT
CGACATACGCGAGTCCAAGCTGCGCACTTCGATCGACGCCTTTATCAAGG
GAGAGGGCACATATGCAAAGCTAGACAACCTCACGCTTCTGGAGATCCAC
AGCGTGAGACCCATTCTGCCCTATTCCCTGGACCACATAGCACGGTACCA
GCGCACGGCCACTGCGTCTCAAAGGGACACCTCCATGCTAAGTGCATCCA
TGGCAGGCTCCAGTTCGGGTCCGAACAGTAACTCTCTGTTTTCTCAGTGA
TTATTCCAGTCAAACAACATTGTTGGGAACATTTAAGATAATAGATTTAG
TTATTAGCAGGAGCTTATGTAGCCTGTAGTCATTAAACCTCTCAAAAGTT
CAAAAATATTTGTATGCTTAAAATTAAATATAAATGCTTTCAGAAAATTA
AAAAAAGCAAAAAAAAAAAAAAAAA

RE26983.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Psf2.c 1537 Psf2.c 727..1531 3..807 4025 100 Plus
Psf2-RA 1063 Psf2-RA 253..1057 3..807 4025 100 Plus
Psf2.e 1522 Psf2.e 712..1516 3..807 4025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4385322..4385845 807..284 2620 100 Minus
chr2L 23010047 chr2L 4385902..4386184 285..3 1415 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4386182..4386705 807..284 2620 100 Minus
2L 23513712 2L 4386762..4387044 285..3 1415 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4386182..4386705 807..284 2620 100 Minus
2L 23513712 2L 4386762..4387044 285..3 1415 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:21:58 has no hits.

RE26983.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:23:01 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4385321..4385845 284..808 99 <- Minus
chr2L 4385904..4386186 1..283 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:00 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..648 3..650 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:59 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..648 3..650 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:01:05 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RB 1..612 39..650 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:40 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..648 3..650 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:37 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RB 1..612 39..650 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:43 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..807 2..808 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:59 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..807 2..808 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:05 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RB 25..831 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:40 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RA 1..807 2..808 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:37 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
Psf2-RB 25..831 1..807 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:23:01 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4386181..4386705 284..808 99 <- Minus
2L 4386764..4387046 1..283 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:23:01 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4386181..4386705 284..808 99 <- Minus
2L 4386764..4387046 1..283 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:23:01 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4386181..4386705 284..808 99 <- Minus
2L 4386764..4387046 1..283 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:05 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4386181..4386705 284..808 99 <- Minus
arm_2L 4386764..4387046 1..283 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:44 Download gff for RE26983.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4386181..4386705 284..808 99 <- Minus
2L 4386764..4387046 1..283 99   Minus

RE26983.pep Sequence

Translation from 2 to 649

> RE26983.pep
MFPHLFCLFIAIMDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRA
GFPVFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMP
CEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKG
EGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTSMLSASM
AGSSSGPNSNSLFSQ*

RE26983.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24109-PA 203 GF24109-PA 1..203 13..215 1040 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24383-PA 203 GG24383-PA 1..203 13..215 1072 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13682-PA 203 GH13682-PA 1..203 13..215 905 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Psf2-PC 203 CG18013-PC 1..203 13..215 1058 100 Plus
Psf2-PB 203 CG18013-PB 1..203 13..215 1058 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17967-PA 205 GI17967-PA 1..205 13..215 926 89.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15443-PA 203 GL15443-PA 1..203 13..215 1060 97.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26065-PA 203 GA26065-PA 1..203 13..215 1060 97.5 Plus
Dpse\GA25496-PA 190 GA25496-PA 1..190 26..215 994 97.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18097-PA 203 GM18097-PA 1..203 13..215 1085 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22714-PA 203 GD22714-PA 1..203 13..215 1085 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16307-PA 215 GJ16307-PA 1..215 13..215 885 84.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24694-PA 212 GK24694-PA 1..212 13..215 909 86.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14744-PA 203 GE14744-PA 1..203 13..215 1074 99 Plus

RE26983.hyp Sequence

Translation from 2 to 649

> RE26983.hyp
MFPHLFCLFIAIMDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRA
GFPVFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMP
CEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKG
EGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTSMLSASM
AGSSSGPNSNSLFSQ*

RE26983.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Psf2-PC 203 CG18013-PC 1..203 13..215 1058 100 Plus
Psf2-PB 203 CG18013-PB 1..203 13..215 1058 100 Plus