Clone RE27048 Report

Search the DGRC for RE27048

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:270
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCanB2-RA
Protein status:RE27048.pep: gold
Sequenced Size:1085

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11217 2003-01-01 Sim4 clustering to Release 3
CG11217 2003-02-13 Blastp of sequenced clone
CanB2 2008-04-29 Release 5.5 accounting
CanB2 2008-08-15 Release 5.9 accounting
CanB2 2008-12-18 5.12 accounting

Clone Sequence Records

RE27048.complete Sequence

1085 bp (1085 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003768

> RE27048.complete
GGACACCAAAAGCTGCTGTGGAAAAACTCATGCACAATAGAAAATAGAAA
ACCGAATATTTCCACAACAAAACCGTAATTCAGCGGCCCAAAAACCACAG
TAGCATGTGCAGGATAGCCCGCGGCGTAGGACTTTAAAGGAAACTAGAGG
AAAACCAAGAGCGGAACGGCGAAAAGAGCGAACTTTATTTGTACTCTATA
GATAGCATCCAAGGAGAACCACAAAAGGCAAAACCAAAATGGGAAATGAA
ACATCACTGCCCATGGAAATGTGTTCCAATTTCGACGCCGACGAGATCCG
GCGGCTGGGCAAACGTTTCCGGAAACTGGACCTGGACAATTCGGGCGCGC
TGAGCGTGGACGAGTTCATGTCGCTGCCGGAGCTGCAACAGAATCCGCTG
GTGCAGCGCGTGATCGACATTTTCGACGCGGACGGCAACGGCGAGGTGGA
CTTCAAGGAGTTCATCCAGGGCGTGTCGCAGTTCAGCGTCAAGGGCGACA
AGCTGTCCAAGTTGCGCTTCGCCTTTCGCATCTATGACATGGACAACGAT
GGTTACATTTCCAATGGCGAACTGTTTCAGGTTTTAAAGATGATGGTAGG
CAATAATCTGAAGGACACGCAACTGCAGCAGATTGTGGACAAGACGATCG
GATTCGCGGATAAGGATGAGGATGGCAAGATCTCGTTCGATGAGTTCTGC
TCTGTGGTCGGCAACACGGACATTCACAAGAAGATGGTAGTCGATGTCTA
AAATAGGTTTAACGCAGATCCTTTTCTACGCGATGTTATTTATTTATTTT
ATACACGTCGGCATCCTTCGATTGTCACTATCACCACTATTCATATGGTT
ATTATTTTTGATCGGCGATTCTCTATAGTTAAATATTGTTATGAGCCTTT
GGCGAGCCAGTTCAGTTAGTCAGTCAGTCAGTCAGCCAGCCAGCCAGTCA
GTCAGTACAGCGATCGAAGGCTTAGGGAGAAATCGCGAATGCAATGTTGT
TATCCTAAGTTGAAAAGTGGAATAATGCGCCTCCTACTTACTTCTTAAAT
ATATTCATCTATATACTTATATATAAAAAAAAAAA

RE27048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
CanB2-RA 1400 CanB2-RA 92..1166 3..1077 5375 100 Plus
CanB2.e 2239 CanB2.e 92..1166 3..1077 5375 100 Plus
CanB2.b 1458 CanB2.b 92..670 3..581 2895 100 Plus
CanB2.b 1458 CanB2.b 726..1224 579..1077 2495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3674910..3675405 579..1074 2480 100 Plus
chr2R 21145070 chr2R 3674555..3674854 282..581 1485 99.7 Plus
chrX 22417052 chrX 5225957..5226465 239..747 1420 85.3 Plus
chr2R 21145070 chr2R 3673351..3673590 3..242 1200 100 Plus
chr2R 21145070 chr2R 3673820..3673860 241..281 205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7787589..7788087 579..1077 2495 100 Plus
2R 25286936 2R 7787234..7787533 282..581 1500 100 Plus
X 23542271 X 5333405..5333913 239..747 1405 85.1 Plus
2R 25286936 2R 7786030..7786269 3..242 1200 100 Plus
2R 25286936 2R 7786499..7786539 241..281 205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7788788..7789286 579..1077 2495 100 Plus
2R 25260384 2R 7788433..7788732 282..581 1500 100 Plus
X 23527363 X 5341503..5342011 239..747 1405 85 Plus
2R 25260384 2R 7787229..7787468 3..242 1200 100 Plus
2R 25260384 2R 7787698..7787738 241..281 205 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:41:48 has no hits.

RE27048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:42:51 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3673347..3673589 1..241 99 -> Plus
chr2R 3673821..3673860 242..281 100 -> Plus
chr2R 3674555..3674853 282..580 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:03 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 1..513 239..751 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:52:14 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 1..513 239..751 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:38 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 1..513 239..751 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:43:21 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 1..513 239..751 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:15 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 1..513 239..751 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:06:10 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 15..1090 1..1074 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:52:14 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 15..1090 1..1074 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:38 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 17..1092 1..1074 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:43:22 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 15..1090 1..1074 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:15 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
CanB2-RA 17..1092 1..1074 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:51 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7786026..7786268 1..241 99 -> Plus
2R 7786500..7786539 242..281 100 -> Plus
2R 7787234..7787532 282..580 100 -> Plus
2R 7787591..7788084 581..1074 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:51 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7786026..7786268 1..241 99 -> Plus
2R 7786500..7786539 242..281 100 -> Plus
2R 7787234..7787532 282..580 100 -> Plus
2R 7787591..7788084 581..1074 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:51 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7786026..7786268 1..241 99 -> Plus
2R 7786500..7786539 242..281 100 -> Plus
2R 7787234..7787532 282..580 100 -> Plus
2R 7787591..7788084 581..1074 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:38 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3673531..3673773 1..241 99 -> Plus
arm_2R 3674005..3674044 242..281 100 -> Plus
arm_2R 3674739..3675037 282..580 100 -> Plus
arm_2R 3675096..3675589 581..1074 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:14:10 Download gff for RE27048.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7787225..7787467 1..241 99 -> Plus
2R 7787699..7787738 242..281 100 -> Plus
2R 7788433..7788731 282..580 100 -> Plus
2R 7788790..7789283 581..1074 100   Plus

RE27048.pep Sequence

Translation from 238 to 750

> RE27048.pep
MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQ
QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYD
MDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISF
DEFCSVVGNTDIHKKMVVDV*

RE27048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13200-PA 170 GF13200-PA 1..170 1..170 876 100 Plus
Dana\GF19757-PA 170 GF19757-PA 1..170 1..170 859 97.6 Plus
Dana\GF17404-PA 189 GF17404-PA 1..185 1..168 309 38.9 Plus
Dana\GF12205-PA 189 GF12205-PA 19..175 12..157 260 36.9 Plus
Dana\GF12835-PA 149 GF12835-PA 1..146 11..157 185 31.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23301-PA 170 GG23301-PA 1..170 1..170 876 100 Plus
Dere\GG18755-PA 170 GG18755-PA 1..170 1..170 859 97.6 Plus
Dere\GG10903-PA 189 GG10903-PA 1..185 1..168 309 38.9 Plus
Dere\GG22065-PA 166 GG22065-PA 55..152 60..157 187 40.8 Plus
Dere\GG20265-PA 149 GG20265-PA 1..146 11..157 185 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24615-PA 170 GH24615-PA 1..170 1..170 859 97.6 Plus
Dgri\GH20317-PA 162 GH20317-PA 1..162 9..170 831 100 Plus
Dgri\GH19192-PA 189 GH19192-PA 1..185 1..168 299 37.8 Plus
Dgri\GH22004-PA 189 GH22004-PA 19..175 12..157 254 36.9 Plus
Dgri\GH14390-PA 190 GH14390-PA 40..169 35..153 189 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
CanB2-PB 170 CG11217-PB 1..170 1..170 874 100 Plus
CanB2-PA 170 CG11217-PA 1..170 1..170 874 100 Plus
CanB-PB 170 CG4209-PB 1..170 1..170 858 97.6 Plus
CanB-PA 170 CG4209-PA 1..170 1..170 858 97.6 Plus
elm-PB 189 CG2185-PB 1..185 1..168 308 38.9 Plus
elm-PA 189 CG2185-PA 1..185 1..168 308 38.9 Plus
Cib2-PB 189 CG9236-PB 19..175 12..157 256 36.9 Plus
Cam-PD 149 CG8472-PD 1..146 11..157 193 31.8 Plus
Cam-PC 149 CG8472-PC 1..146 11..157 193 31.8 Plus
Cam-PE 149 CG8472-PE 1..146 11..157 193 31.8 Plus
Cam-PB 149 CG8472-PB 1..146 11..157 193 31.8 Plus
Cam-PA 149 CG8472-PA 1..146 11..157 193 31.8 Plus
Frq1-PE 187 CG5744-PE 22..168 15..153 193 35.3 Plus
Frq1-PD 187 CG5744-PD 22..168 15..153 193 35.3 Plus
Frq1-PC 187 CG5744-PC 22..168 15..153 193 35.3 Plus
Frq1-PB 187 CG5744-PB 22..168 15..153 193 35.3 Plus
Nca-PA 190 CG7641-PA 40..169 35..153 186 35.1 Plus
Nox-PB 1282 CG34399-PB 323..462 13..151 179 31 Plus
Nox-PE 1340 CG34399-PE 323..462 13..151 179 31 Plus
Nox-PD 1340 CG34399-PD 323..462 13..151 179 31 Plus
Nox-PC 1340 CG34399-PC 323..462 13..151 179 31 Plus
CG31960-PA 148 CG31960-PA 19..145 30..157 178 35.6 Plus
Frq2-PD 187 CG5907-PD 22..168 15..153 177 33.3 Plus
Frq2-PC 187 CG5907-PC 22..168 15..153 177 33.3 Plus
Frq2-PB 187 CG5907-PB 22..168 15..153 177 33.3 Plus
Frq2-PA 187 CG5907-PA 22..168 15..153 177 33.3 Plus
TpnC47D-PB 155 CG9073-PB 11..152 18..157 168 30.6 Plus
TpnC47D-PA 155 CG9073-PA 11..152 18..157 168 30.6 Plus
azot-PA 148 CG11165-PA 16..145 27..157 161 31.9 Plus
CG11638-PA 387 CG11638-PA 210..359 19..161 161 27.7 Plus
TpnC73F-PC 155 CG7930-PC 11..152 18..157 157 29.3 Plus
TpnC73F-PA 155 CG7930-PA 11..152 18..157 157 29.3 Plus
Acam-PB 148 CG17769-PB 2..141 13..153 148 29.7 Plus
Acam-PA 148 CG17769-PA 2..141 13..153 148 29.7 Plus
TpnC4-PB 153 CG12408-PB 6..151 15..157 147 27.8 Plus
TpnC4-PA 153 CG12408-PA 6..151 15..157 147 27.8 Plus
Eip63F-1-PD 166 CG15855-PD 7..161 17..153 139 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11077-PA 170 GI11077-PA 1..170 1..170 859 97.6 Plus
Dmoj\GI19990-PA 160 GI19990-PA 1..160 11..170 820 100 Plus
Dmoj\GI24225-PA 189 GI24225-PA 1..185 1..168 304 38.4 Plus
Dmoj\GI19707-PA 189 GI19707-PA 19..175 12..157 254 36.9 Plus
Dmoj\GI11334-PA 190 GI11334-PA 40..169 35..153 189 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10837-PA 170 GL10837-PA 1..170 1..170 876 100 Plus
Dper\GL14682-PA 170 GL14682-PA 1..170 1..170 859 97.6 Plus
Dper\GL23144-PA 189 GL23144-PA 1..185 1..168 305 37.3 Plus
Dper\GL17058-PA 189 GL17058-PA 19..175 12..157 260 36.9 Plus
Dper\GL11703-PA 149 GL11703-PA 3..147 12..157 185 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18033-PA 170 GA18033-PA 1..170 1..170 859 97.6 Plus
Dpse\GA24505-PA 305 GA24505-PA 148..305 13..170 807 98.7 Plus
Dpse\GA27156-PA 189 GA27156-PA 1..185 1..168 305 37.3 Plus
Dpse\GA21632-PA 189 GA21632-PA 19..175 12..157 260 36.9 Plus
Dpse\GA24499-PA 149 GA24499-PA 1..146 11..157 185 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20979-PA 170 GM20979-PA 1..170 1..170 876 100 Plus
Dsec\GM12403-PA 170 GM12403-PA 1..170 1..170 859 97.6 Plus
Dsec\GM15782-PA 206 GM15782-PA 45..192 12..157 217 35 Plus
Dsec\GM10604-PA 105 GM10604-PA 24..101 91..168 194 48.7 Plus
Dsec\GM21351-PA 149 GM21351-PA 1..146 11..157 185 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15356-PA 170 GD15356-PA 1..170 1..170 876 100 Plus
Dsim\GD10507-PA 170 GD10507-PA 1..170 1..170 876 100 Plus
Dsim\GD19593-PA 189 GD19593-PA 1..185 1..168 303 38.4 Plus
Dsim\GD11545-PA 206 GD11545-PA 45..192 12..157 217 35 Plus
Dsim\GD10849-PA 149 GD10849-PA 1..146 11..157 185 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21239-PA 177 GJ21239-PA 9..177 2..170 867 99.4 Plus
Dvir\GJ14779-PA 170 GJ14779-PA 1..170 1..170 859 97.6 Plus
Dvir\GJ10797-PA 189 GJ10797-PA 1..185 1..168 302 38.4 Plus
Dvir\GJ17436-PA 189 GJ17436-PA 19..175 12..157 254 36.9 Plus
Dvir\GJ11590-PA 190 GJ11590-PA 40..169 35..153 186 34.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21716-PA 170 GK21716-PA 1..170 1..170 876 100 Plus
Dwil\GK10056-PA 170 GK10056-PA 1..170 1..170 859 97.6 Plus
Dwil\GK10850-PA 189 GK10850-PA 1..185 1..168 302 38.9 Plus
Dwil\GK23329-PA 188 GK23329-PA 19..174 12..157 256 36.5 Plus
Dwil\GK22183-PA 149 GK22183-PA 1..146 11..157 185 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19147-PA 170 GE19147-PA 1..170 1..170 876 100 Plus
Dyak\GE16397-PA 170 GE16397-PA 1..170 1..170 859 97.6 Plus
Dyak\GE24150-PA 189 GE24150-PA 1..185 1..168 309 38.9 Plus
Dyak\GE12146-PA 166 GE12146-PA 55..152 60..157 186 40.8 Plus
Dyak\Cam-PA 149 GE12425-PA 1..146 11..157 185 31.8 Plus

RE27048.hyp Sequence

Translation from 238 to 750

> RE27048.hyp
MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQ
QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYD
MDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISF
DEFCSVVGNTDIHKKMVVDV*

RE27048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
CanB2-PB 170 CG11217-PB 1..170 1..170 874 100 Plus
CanB2-PA 170 CG11217-PA 1..170 1..170 874 100 Plus
CanB-PB 170 CG4209-PB 1..170 1..170 858 97.6 Plus
CanB-PA 170 CG4209-PA 1..170 1..170 858 97.6 Plus
elm-PB 189 CG2185-PB 1..185 1..168 308 38.9 Plus