Clone RE27306 Report

Search the DGRC for RE27306

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:273
Well:6
Vector:pFlc-1
Associated Gene/TranscriptObp83g-RA
Protein status:RE27306.pep: gold
Preliminary Size:1107
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15583 2002-01-01 Sim4 clustering to Release 2
CG31558 2002-04-21 Blastp of sequenced clone
CG31558 2003-01-01 Sim4 clustering to Release 3
Obp83g 2008-04-29 Release 5.5 accounting
Obp83g 2008-08-15 Release 5.9 accounting
Obp83g 2008-12-18 5.12 accounting

Clone Sequence Records

RE27306.complete Sequence

580 bp (580 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113437

> RE27306.complete
AGTCGCTAACCCGTCGGCACATTCGCACTTGAGCCCTCGTCCGAGCCAGA
AATGCAGTCCCAATCCCTCCTGCTGATCGTTGCAGCCGTTGCCACGTTTC
TGGTGGCCCAGACTACGGCCAAGTTCCTGCTGAAGGACCACGCCGACGCA
GAGAAGGCGTTCGAGGAGTGCCGTGAGGACTACTACGTGCCGGACGACAT
CTACGAGAAGTACCTGAACTACGAGTTTCCCGCCCACCGGCGCACCAGCT
GCTTCGTCAAGTGCTTCCTGGAGAAGCTTGAGCTGTTCTCGGAGAAGAAG
GGATTTGACGAGCGCGCCATGATCGCCCAGTTCACCTCCAAGAGCAGCAA
AGACCTGTCCACGGTCCAGCACGGCCTGGAGAAGTGCATCGACCACAACG
AGGCCGAGTCGGATGTCTGCACCTGGGCCAACCGAGTCTTCTCCTGCTGG
CTGCCCATCAACCGCCACGTGGTGCGTAAGGTCTTCGCCTGACCTGAATG
TGATATAATACACTGTACGCCTTACAGGATAATGTAGAAATAAACATTTT
TAGTTTTCAGATATAAAAAAAAAAAAAAAA

RE27306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83g-RA 833 Obp83g-RA 160..724 1..565 2825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1937311..1937766 564..109 2280 100 Minus
chr3R 27901430 chr3R 1937827..1937937 111..1 555 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6111670..6112126 565..109 2285 100 Minus
3R 32079331 3R 6112187..6112297 111..1 555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5852501..5852957 565..109 2285 100 Minus
3R 31820162 3R 5853018..5853128 111..1 555 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:19:04 has no hits.

RE27306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:19:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1937311..1937763 112..564 100 <- Minus
chr3R 1937827..1937937 1..111 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:17 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..441 52..492 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:28 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..441 52..492 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:23 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..441 52..492 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..441 52..492 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:25 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..441 52..492 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:43 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:28 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:23 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 6..569 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:25 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83g-RA 6..569 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6112187..6112297 1..111 100   Minus
3R 6111671..6112123 112..564 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6112187..6112297 1..111 100   Minus
3R 6111671..6112123 112..564 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:56 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6112187..6112297 1..111 100   Minus
3R 6111671..6112123 112..564 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:23 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1937393..1937845 112..564 100 <- Minus
arm_3R 1937909..1938019 1..111 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:28 Download gff for RE27306.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5852502..5852954 112..564 100 <- Minus
3R 5853018..5853128 1..111 100   Minus

RE27306.pep Sequence

Translation from 51 to 491

> RE27306.pep
MQSQSLLLIVAAVATFLVAQTTAKFLLKDHADAEKAFEECREDYYVPDDI
YEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSK
DLSTVQHGLEKCIDHNEAESDVCTWANRVFSCWLPINRHVVRKVFA*

RE27306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18627-PA 145 GF18627-PA 1..145 1..146 633 80.1 Plus
Dana\GF23357-PA 142 GF23357-PA 3..139 10..146 203 31.4 Plus
Dana\GF11209-PA 144 GF11209-PA 4..137 12..142 166 30.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10577-PA 145 GG10577-PA 1..145 1..146 692 89 Plus
Dere\GG11676-PA 144 GG11676-PA 3..141 8..146 180 28.8 Plus
Dere\GG10672-PA 143 GG10672-PA 4..137 12..142 168 30.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14285-PA 149 GH14285-PA 6..146 7..146 543 69.5 Plus
Dgri\GH19983-PA 144 GH19983-PA 1..137 1..142 189 30.3 Plus
Dgri\GH18907-PA 149 GH18907-PA 9..125 16..132 174 28.2 Plus
Dgri\GH13991-PA 157 GH13991-PA 34..153 25..143 156 29.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83g-PA 146 CG31558-PA 1..146 1..146 770 100 Plus
Obp99a-PB 142 CG18111-PB 10..139 17..146 189 30 Plus
Obp99a-PA 142 CG18111-PA 10..139 17..146 189 30 Plus
Obp44a-PB 143 CG2297-PB 4..137 12..142 171 30.4 Plus
Obp44a-PA 143 CG2297-PA 4..137 12..142 171 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23179-PA 147 GI23179-PA 1..146 1..145 560 67.8 Plus
Dmoj\GI20270-PA 144 GI20270-PA 1..137 1..142 181 29.6 Plus
Dmoj\GI23406-PA 142 GI23406-PA 9..139 16..146 179 28 Plus
Dmoj\GI22335-PA 154 GI22335-PA 28..150 22..143 151 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23482-PA 145 GL23482-PA 1..145 1..146 589 77.4 Plus
Dper\GL13898-PA 142 GL13898-PA 10..139 17..146 177 26.9 Plus
Dper\GL17379-PA 144 GL17379-PA 1..138 1..142 175 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp83g-PA 145 GA16322-PA 1..145 1..146 592 78.1 Plus
Dpse\Obp99a-PA 142 GA14801-PA 10..139 17..146 177 26.9 Plus
Dpse\Obp44a-PA 144 GA15343-PA 1..138 1..142 175 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10567-PA 145 GM10567-PA 1..145 1..146 728 94.5 Plus
Dsec\GM12800-PA 142 GM12800-PA 10..139 17..146 193 30.8 Plus
Dsec\GM20719-PA 143 GM20719-PA 11..137 15..142 166 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp83g-PA 145 GD19559-PA 1..145 1..146 735 95.9 Plus
Dsim\Obp99a-PA 142 GD21447-PA 10..139 17..146 189 30 Plus
Dsim\Obp44a-PA 143 GD10185-PA 4..137 12..142 169 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp83g-PA 148 GJ14492-PA 1..146 1..146 577 70.5 Plus
Dvir\Obp44a-PA 144 GJ20223-PA 4..137 12..142 178 31.1 Plus
Dvir\Obp99a-PA 142 GJ10612-PA 4..139 9..146 168 26.8 Plus
Dvir\Obp99b-PA 162 GJ10523-PA 33..157 19..142 155 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14209-PA 144 GK14209-PA 1..144 1..146 609 75.3 Plus
Dwil\GK23043-PA 144 GK23043-PA 1..137 1..142 176 29.6 Plus
Dwil\GK11908-PA 142 GK11908-PA 9..127 16..134 167 26.1 Plus
Dwil\GK11170-PA 158 GK11170-PA 31..153 23..142 166 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24115-PA 145 GE24115-PA 1..145 1..146 637 82.9 Plus
Dyak\Obp99a-PA 144 GE23865-PA 3..141 8..146 179 28.1 Plus
Dyak\GE23275-PA 143 GE23275-PA 4..137 12..142 177 31.9 Plus

RE27306.hyp Sequence

Translation from 51 to 491

> RE27306.hyp
MQSQSLLLIVAAVATFLVAQTTAKFLLKDHADAEKAFEECREDYYVPDDI
YEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSK
DLSTVQHGLEKCIDHNEAESDVCTWANRVFSCWLPINRHVVRKVFA*

RE27306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83g-PA 146 CG31558-PA 1..146 1..146 770 100 Plus
Obp99a-PB 142 CG18111-PB 10..139 17..146 189 30 Plus
Obp99a-PA 142 CG18111-PA 10..139 17..146 189 30 Plus
Obp44a-PB 143 CG2297-PB 4..137 12..142 171 30.4 Plus
Obp44a-PA 143 CG2297-PA 4..137 12..142 171 30.4 Plus