Clone RE27552 Report

Search the DGRC for RE27552

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:275
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCG13197-RA
Protein status:RE27552.pep: gold
Preliminary Size:357
Sequenced Size:1279

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13197 2002-01-01 Sim4 clustering to Release 2
CG13197 2002-03-21 Blastp of sequenced clone
CG13197 2003-01-01 Sim4 clustering to Release 3
CG13197 2008-04-29 Release 5.5 accounting
CG13197 2008-08-15 Release 5.9 accounting
CG13197 2008-12-18 5.12 accounting

Clone Sequence Records

RE27552.complete Sequence

1279 bp (1279 high quality bases) assembled on 2002-03-21

GenBank Submission: AY094864

> RE27552.complete
GAGGATTATTTCTTTGCAAAACATTGTCAACAATTTTGAAGAACTTCGAA
ATTTTATTTTTAAATTTCGGTAAAAGGTTTGGCGAACAGACAAAATGGTC
AAGGACATACCAGACAGATGGCTGAAGTACAAACCGATTGGAGATCGTGT
TCCTGGCACTCGTTTCATAGCCTTTAAGGTGCCGCTGAATCAGCATGTCA
ACGCCAAAGTGAAGGAGAATCTTCGGCTGGCGCCCGAATCCCTTCTGCAG
ATCGTACCCGATATGGGTCTCATCATCGATTTGACCAACACGAATCGATA
CTACCACCCAAGTGCCATAACCAACCACGATGTGCTCCACCAGAAGCTGA
TGATCCCCGGAAAACAGACACCCTCGCATAAGCTAGCCCAAAGATTCTGT
GCTTTCGTGACTGACTTCCTTGAAAGGAACGCGGATAATGACAAACTAAT
TGGCGTCCATTGCACACATGGAGTAAATCGAACTGGATACCTGATCTGCT
ACTTCATGATCTCCGTAATGAACATGTCCCCTGAGGAGGCGATACAAACC
TTTTCTTTGGCCCGCGGCCATGAAATCGAACGCGACAATTACCTGAGCTC
TCTAAAGACACTCCCGAATCGGGAGACCGTAACGAAGCTTGCTGCCACAG
AGAGGAGATCATCCACAATAGATAATTGGCGTCAGCCAATTGATTACCAA
AGCGAAAGAGATTTGCATCAGAAAAACAACCACAGACTGTCAAAAGTCTT
GAAAACGAAATCCTATCAGGAACACGACGACTGTCGAAGACGCGACCGCT
GGAACCAACATCCTTATGCCCGTAACCATAGACCGCATCCAGTCGAAGAA
CAAAGAAGGATTCAAAGTAACCGATCTAGAGATGGATATCAGCAGGGCTC
GAACCAACATCCTTATTCCCGTAACCATAGACCGCATCCAGTCGAAGAGC
AATATAGGATTCAAAGTAACCGATCAGGAGGAGGCTATCAGCAGGGCTCG
ATAAGCTATCAACAGGAACCTCATCAAAGGTATCAAAGGAACTGGGATTA
TTCGAGAAGAAACTATAGCGAAAGAAACTACAGTGAAAGAAACTGGAGCG
AAAGAAACTACAGCGATCAAAAGTAGCCGCTTCGTTCGATTTAATATTAT
AGTTTTAAAAAATCCTTGAGTGTAAAAAATTTCCAACGGTGTGTTGATCA
ATTTGTAAATTATTGCTAATTAGCTGCAACTACAGGTACGGCAATTAAAA
TTCATTTGAGACCAAAAAAAAAAAAAAAA

RE27552.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13197-RA 1573 CG13197-RA 57..1316 5..1264 6300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7582227..7582755 735..1263 2645 100 Plus
chr2R 21145070 chr2R 7579276..7579478 191..393 1015 100 Plus
chr2R 21145070 chr2R 7581964..7582150 549..735 935 100 Plus
chr2R 21145070 chr2R 7578611..7578723 5..117 565 100 Plus
chr2R 21145070 chr2R 7581782..7581890 440..548 545 100 Plus
chr2R 21145070 chr2R 7578808..7578886 115..193 395 100 Plus
chr2R 21145070 chr2R 7582290..7582394 897..1001 360 89.5 Plus
chr2R 21145070 chr2R 7582389..7582493 798..902 360 89.5 Plus
chr2R 21145070 chr2R 7579808..7579856 392..440 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11694918..11695447 735..1264 2650 100 Plus
2R 25286936 2R 11691965..11692167 191..393 1015 100 Plus
2R 25286936 2R 11694655..11694841 549..735 935 100 Plus
2R 25286936 2R 11691300..11691412 5..117 565 100 Plus
2R 25286936 2R 11694473..11694581 440..548 545 100 Plus
2R 25286936 2R 11691497..11691575 115..193 395 100 Plus
2R 25286936 2R 11694981..11695085 897..1001 360 89.5 Plus
2R 25286936 2R 11695080..11695184 798..902 360 89.5 Plus
2R 25286936 2R 11692497..11692545 392..440 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11696117..11696646 735..1264 2650 100 Plus
2R 25260384 2R 11693164..11693366 191..393 1015 100 Plus
2R 25260384 2R 11695854..11696040 549..735 935 100 Plus
2R 25260384 2R 11692499..11692611 5..117 565 100 Plus
2R 25260384 2R 11695672..11695780 440..548 545 100 Plus
2R 25260384 2R 11692696..11692774 115..193 395 100 Plus
2R 25260384 2R 11693696..11693744 392..440 245 100 Plus
Blast to na_te.dros performed 2019-03-16 07:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
FB 1106 FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). 496..564 80..19 122 69.6 Minus

RE27552.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:43:51 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7578607..7578723 1..117 98 -> Plus
chr2R 7578811..7578886 118..193 100 -> Plus
chr2R 7579279..7579478 194..393 100 -> Plus
chr2R 7579810..7579856 394..440 100 -> Plus
chr2R 7581783..7581890 441..548 100 -> Plus
chr2R 7581964..7582149 549..734 100 -> Plus
chr2R 7582227..7582755 735..1263 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:29 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 1..1032 95..1126 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:24:38 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 1..1032 95..1126 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:25:09 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 1..1032 95..1126 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:23 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 1..1032 95..1126 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:03 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 1..1032 95..1126 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:16 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:24:37 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:25:09 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 12..1274 1..1263 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:24 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 2..1263 2..1263 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:03 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13197-RA 12..1274 1..1263 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:51 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11691296..11691412 1..117 98 -> Plus
2R 11691500..11691575 118..193 100 -> Plus
2R 11691968..11692167 194..393 100 -> Plus
2R 11692499..11692545 394..440 100 -> Plus
2R 11694474..11694581 441..548 100 -> Plus
2R 11694655..11694840 549..734 100 -> Plus
2R 11694918..11695446 735..1263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:51 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11691296..11691412 1..117 98 -> Plus
2R 11691500..11691575 118..193 100 -> Plus
2R 11691968..11692167 194..393 100 -> Plus
2R 11692499..11692545 394..440 100 -> Plus
2R 11694474..11694581 441..548 100 -> Plus
2R 11694655..11694840 549..734 100 -> Plus
2R 11694918..11695446 735..1263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:51 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11691296..11691412 1..117 98 -> Plus
2R 11691500..11691575 118..193 100 -> Plus
2R 11691968..11692167 194..393 100 -> Plus
2R 11692499..11692545 394..440 100 -> Plus
2R 11694474..11694581 441..548 100 -> Plus
2R 11694655..11694840 549..734 100 -> Plus
2R 11694918..11695446 735..1263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:25:09 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7582160..7582345 549..734 100 -> Plus
arm_2R 7578801..7578917 1..117 98 -> Plus
arm_2R 7579005..7579080 118..193 100 -> Plus
arm_2R 7579473..7579672 194..393 100 -> Plus
arm_2R 7580004..7580050 394..440 100 -> Plus
arm_2R 7581979..7582086 441..548 100 -> Plus
arm_2R 7582423..7582951 735..1263 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:26 Download gff for RE27552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11696117..11696645 735..1263 100   Plus
2R 11692495..11692611 1..117 98 -> Plus
2R 11692699..11692774 118..193 100 -> Plus
2R 11693167..11693366 194..393 100 -> Plus
2R 11693698..11693744 394..440 100 -> Plus
2R 11695673..11695780 441..548 100 -> Plus
2R 11695854..11696039 549..734 100 -> Plus

RE27552.pep Sequence

Translation from 94 to 1125

> RE27552.pep
MVKDIPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESL
LQIVPDMGLIIDLTNTNRYYHPSAITNHDVLHQKLMIPGKQTPSHKLAQR
FCAFVTDFLERNADNDKLIGVHCTHGVNRTGYLICYFMISVMNMSPEEAI
QTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATERRSSTIDNWRQPID
YQSERDLHQKNNHRLSKVLKTKSYQEHDDCRRRDRWNQHPYARNHRPHPV
EEQRRIQSNRSRDGYQQGSNQHPYSRNHRPHPVEEQYRIQSNRSGGGYQQ
GSISYQQEPHQRYQRNWDYSRRNYSERNYSERNWSERNYSDQK*

RE27552.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11454-PA 369 GF11454-PA 1..189 2..189 723 67.7 Plus
Dana\GF15987-PA 672 GF15987-PA 21..189 5..170 257 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20215-PA 302 GG20215-PA 1..294 1..342 927 56.9 Plus
Dere\GG19463-PA 652 GG19463-PA 15..183 5..170 259 36 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22885-PA 378 GH22885-PA 1..173 1..173 673 67.6 Plus
Dgri\GH11798-PA 642 GH11798-PA 15..183 5..170 272 37.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13197-PB 343 CG13197-PB 1..343 1..343 1864 100 Plus
CG13197-PA 343 CG13197-PA 1..343 1..343 1864 100 Plus
mRNA-cap-PA 649 CG1810-PA 15..183 5..170 242 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21271-PA 388 GI21271-PA 1..207 1..206 701 62.8 Plus
Dmoj\GI15976-PA 638 GI15976-PA 13..181 5..170 261 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10081-PA 385 GL10081-PA 1..175 1..175 690 69.7 Plus
Dper\GL14931-PA 599 GL14931-PA 15..183 5..170 266 36.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12112-PA 385 GA12112-PA 1..175 1..175 691 70.3 Plus
Dpse\GA14791-PA 655 GA14791-PA 15..183 5..170 266 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21302-PA 351 GM21302-PA 1..229 1..228 1087 88.2 Plus
Dsec\GM17561-PA 651 GM17561-PA 15..183 5..170 249 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10810-PA 402 GD10810-PA 1..389 1..340 1405 71.7 Plus
Dsim\GD15855-PA 651 GD15855-PA 15..183 5..170 249 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20873-PA 401 GJ20873-PA 1..174 1..173 684 70.1 Plus
Dvir\GJ19096-PA 637 GJ19096-PA 15..183 5..170 262 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17880-PA 397 GK17880-PA 1..237 1..245 729 57.1 Plus
Dwil\GK24975-PA 639 GK24975-PA 16..184 5..170 261 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12375-PA 329 GE12375-PA 1..321 1..340 963 57.1 Plus
Dyak\GE16118-PA 750 GE16118-PA 111..279 5..170 261 36 Plus

RE27552.hyp Sequence

Translation from 94 to 1125

> RE27552.hyp
MVKDIPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESL
LQIVPDMGLIIDLTNTNRYYHPSAITNHDVLHQKLMIPGKQTPSHKLAQR
FCAFVTDFLERNADNDKLIGVHCTHGVNRTGYLICYFMISVMNMSPEEAI
QTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATERRSSTIDNWRQPID
YQSERDLHQKNNHRLSKVLKTKSYQEHDDCRRRDRWNQHPYARNHRPHPV
EEQRRIQSNRSRDGYQQGSNQHPYSRNHRPHPVEEQYRIQSNRSGGGYQQ
GSISYQQEPHQRYQRNWDYSRRNYSERNYSERNWSERNYSDQK*

RE27552.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13197-PB 343 CG13197-PB 1..343 1..343 1864 100 Plus
CG13197-PA 343 CG13197-PA 1..343 1..343 1864 100 Plus
mRNA-cap-PA 649 CG1810-PA 15..183 5..170 242 34.9 Plus