Clone RE27904 Report

Search the DGRC for RE27904

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:279
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG32276-RA
Protein status:RE27904.pep: gold
Sequenced Size:878

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32276 2001-12-14 Blastp of sequenced clone
CG14966 2002-01-01 Sim4 clustering to Release 2
CG32276 2003-01-01 Sim4 clustering to Release 3
CG32276 2008-04-29 Release 5.5 accounting
CG32276 2008-08-15 Release 5.9 accounting
CG32276 2008-12-18 5.12 accounting

Clone Sequence Records

RE27904.complete Sequence

878 bp (878 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071239

> RE27904.complete
AGTATACGTGTCGTCGCTTTCTCATTCGTTTTGTTATTTTTGGGCTGAAA
GGTACGCTGTTTTCTCGGGCAACTGCAAAGCCACAGCTTGTTCCGTTTCA
TTTCGAAGTTATCAATTGCACGCAAGCTGCAGCCCAATCAATAGGCAATT
AACAAACAATTCATTTGCGAATTTCAGTGAGATTGTGCTTCAACAACAAC
ACAAGAAAATGGCTCCACCACAGAGAATGCGCGTCGCTAACGAGAAGGCC
AGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCGAAAACGAA
AGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTTCATCTTTG
TGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATACGCGCCGCG
TAAGGAAAGGCTTCACCTCGCATAAGATACACAGAGAGCAGGTGCATCTG
GAGGAAGATAATAGACCTTTCCGGAACCTTCACTTGCTACTACTAACACC
TTCCCTAGCTTAATAGTCCCCGGCAACATGTGCAACCAGAGGATGACCCC
AAACAACTTGGCTTTATTATCGTTTCTGCAATATCAACTCCTATAAAACA
CATACAAAATTTAAGTCCATTTAAAGCATTTTGCATTAATTGATTTAACT
GTAAGCTCTGCAATGTGCATTCCTGCAATTCTCTCCTAAGCAACTGAATA
ATGATCCCCGATCATTTATAGGCGATAAATGCATTTTTAAGATGCTTCTC
GGCGCAGTTTTAAATAGTGCAAAGTGTTAAAGCGTTGTTTTCTAATGCAA
AGACGAGTAGAGAAGAAACTATGAGTACATAACAATGATGAATATATGAT
AATTTTTTACCGAAAAAAAAAAAAAAAA

RE27904.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RA 985 CG32276-RA 50..910 1..861 4305 100 Plus
CG32276-RB 859 CG32276-RB 99..784 176..861 3430 100 Plus
CG32276.a 914 CG32276.a 154..839 176..861 3430 100 Plus
CG32276-RB 859 CG32276-RB 50..100 1..51 255 100 Plus
CG32276.a 914 CG32276.a 105..155 1..51 255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3197262..3197831 861..292 2850 100 Minus
chr3L 24539361 chr3L 3198151..3198442 292..1 1460 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3197863..3198432 861..292 2850 100 Minus
3L 28110227 3L 3198752..3199043 292..1 1460 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3197863..3198432 861..292 2850 100 Minus
3L 28103327 3L 3198752..3199043 292..1 1460 100 Minus
Blast to na_te.dros performed 2019-03-16 04:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 349..497 710..857 129 56.7 Plus

RE27904.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:55:55 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3197261..3197830 293..862 99 <- Minus
chr3L 3198151..3198442 1..292 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:43 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RB 1..195 209..403 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:36 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RB 1..195 209..403 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:44:46 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 1..195 209..403 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:47 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RB 1..195 209..403 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:33 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 1..195 209..403 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:32 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 1..861 1..862 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:36 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 1..861 1..861 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:44:46 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 5..865 1..861 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:47 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 1..861 1..862 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:33 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 5..865 1..861 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:55 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197862..3198431 293..862 99 <- Minus
3L 3198752..3199043 1..292 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:55 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197862..3198431 293..862 99 <- Minus
3L 3198752..3199043 1..292 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:55 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197862..3198431 293..862 99 <- Minus
3L 3198752..3199043 1..292 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:44:46 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3197862..3198431 293..862 99 <- Minus
arm_3L 3198752..3199043 1..292 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:01 Download gff for RE27904.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197862..3198431 293..862 99 <- Minus
3L 3198752..3199043 1..292 100   Minus

RE27904.hyp Sequence

Translation from 0 to 402

> RE27904.hyp
VYVSSLSHSFCYFWAERYAVFSGNCKATACSVSFRSYQLHASCSPINRQL
TNNSFANFSEIVLQQQHKKMAPPQRMRVANEKASKYVTMRGNVPKSSKTK
EGQYPVGPWLLALFIFVVCGSAIFQIVQSIRAA*

RE27904.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PB 64 CG32276-PB 1..64 70..133 327 100 Plus
CG32276-PA 64 CG32276-PA 1..64 70..133 327 100 Plus

RE27904.pep Sequence

Translation from 208 to 402

> RE27904.pep
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVC
GSAIFQIVQSIRAA*

RE27904.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24382-PA 64 GF24382-PA 1..64 1..64 331 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14279-PA 64 GG14279-PA 1..64 1..64 325 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15253-PA 64 GH15253-PA 1..64 1..64 326 96.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PB 64 CG32276-PB 1..64 1..64 327 100 Plus
CG32276-PA 64 CG32276-PA 1..64 1..64 327 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11962-PA 64 GI11962-PA 1..64 1..64 331 98.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25245-PA 64 GL25245-PA 1..64 1..64 326 96.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16804-PA 64 GA16804-PA 1..64 1..64 326 96.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14072-PA 64 GM14072-PA 1..64 1..64 333 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13346-PA 64 GD13346-PA 1..64 1..64 333 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12186-PA 64 GJ12186-PA 1..64 1..64 326 96.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25584-PA 64 GK25584-PA 1..64 1..64 331 98.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20707-PA 64 GE20707-PA 1..64 1..64 331 98.4 Plus