Clone RE28175 Report

Search the DGRC for RE28175

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:281
Well:75
Vector:pFlc-1
Associated Gene/TranscriptProsalpha4-RA
Protein status:RE28175.pep: gold
Preliminary Size:985
Sequenced Size:1190

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3422 2001-12-14 Blastp of sequenced clone
CG3422 2002-01-01 Sim4 clustering to Release 2
Pros28.1 2008-04-29 Release 5.5 accounting
Pros28.1 2008-08-15 Release 5.9 accounting
Pros28.1 2008-12-18 5.12 accounting

Clone Sequence Records

RE28175.complete Sequence

1190 bp (1190 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071241

> RE28175.complete
AATTTAGTAATTTTCATCGAACCCATGCTGCGGTCACACTGCGGCATTTC
CTCAAAAAAGCATCATCATTGCCTGGCGAATTCGAGAAGGAAAAAGCTAT
AAGTTAATATTCTGCAAGTACCTCAGCTATTGAATAAAGCAACAAGATGT
CCTCACGCTACGATCGTGCTGTAACCATATTCTCTCCCGACGGTCACCTC
CTGCAGGTGGAGTATGCCCAGGAGGCCGTTCGCAAGGGATCGACTGCGGT
CGGAGTTCGCGGCGCCAACTGCGTTGTGCTTGGCGTGGAGAAGAAGTCGG
TGGCCCAACTGCAGGAGGATCGAAAGGTGCGCAAGATTTGCATGCTCGAC
AACCACGTTGTAATGGCTTTTGCCGGTCTCACGGCCGACGCTCGCATCAT
GATCAATCGTGCCCAGGTGGAGTGCCAGAGCCATCGTCTCAATGTCGAGG
ATCCCGTGACCCTCGAGTACATAACCAGATTCATTGCCCAGCTGAAACAA
AAATACACGCAGAGCAATGGCCGCCGTCCCTTCGGTATTTCCTGCCTTAT
TGGCGGCTTCGATGCCGATGGCTCTGCGCATCTGTTCCAGACTGAGCCGT
CGGGCATTTTCTACGAGTATAAGGCTAACGCCACCGGGCGATCGGCAAAG
GTTGTGCGCGAGTTCTTCGAGAAGTCCTACCGCGAGGAGGAGGTGGCCAA
CGAGCACGGAGCCGTCAAACTGGCCATCCGTGCGCTGCTCGAGGTGGCGC
AGTCAGGCCAGAACAATCTGGAGGTGGCCATCATGGAGAACGGCAAGCCA
CTGAAAATGCTGGACACCGATGTCATTACCGATTATGTTAAGATCATCGA
GAAGGAGAAGGAGGAGGAGCTCGAGAAGAAGAAACAGAAAAAGTAACACC
CAGCAGCTGGGACACTTCTTCGATGGAAGGCCGTTGCATTGAATCGCTTT
CCATGCATTCGGCGACACTATCTGGTGTCGCCGCCCACATTCTGTCTGCT
CATTGTAGCCAACCTGATTTGACTTGGAAAACGATTCAAATTGAATTCGG
TGAACCGAATGCATACTTTTTTTAATTACCACTTTCTATTCTTCGGAACC
CTGTAAAACGGTATGAAAATATTTGATCTGTATAAAATACATGCGTCATC
ATACATTAGGCGGAGCTCCTGTTGAAAAAAAAAAAAAAAA

RE28175.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Pros28_1-RA 1236 Pros28_1-RA 40..1215 1..1176 5880 100 Plus
Pros28_1A-RA 946 Pros28_1A-RA 56..589 146..679 1080 80.1 Plus
Pros28_1B-RA 1331 Pros28_1B-RA 253..608 282..637 700 79.7 Plus
Pros28_1B-RA 1331 Pros28_1B-RA 130..217 159..246 245 85.2 Plus
Pros28_1A-RA 946 Pros28_1A-RA 678..726 768..816 170 89.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16166591..16167288 477..1174 3475 99.9 Plus
chrX 22417052 chrX 16165973..16166222 1..250 1250 100 Plus
chr3R 27901430 chr3R 16572264..16572934 816..146 1180 78.4 Minus
chrX 22417052 chrX 16166297..16166527 248..478 1155 100 Plus
chr2R 21145070 chr2R 20387691..20387885 476..282 390 80 Minus
chr2R 21145070 chr2R 20387350..20387511 637..476 330 80.2 Minus
chr2R 21145070 chr2R 20387981..20388072 250..159 250 84.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16276890..16277589 477..1176 3500 100 Plus
X 23542271 X 16276272..16276521 1..250 1250 100 Plus
3R 32079331 3R 20748349..20749019 816..146 1180 78.4 Minus
X 23542271 X 16276596..16276826 248..478 1155 100 Plus
2R 25286936 2R 24501794..24501988 476..282 390 80 Minus
2R 25286936 2R 24501453..24501614 637..476 330 80.2 Minus
2R 25286936 2R 24502084..24502175 250..159 250 84.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16284988..16285687 477..1176 3500 100 Plus
X 23527363 X 16284370..16284619 1..250 1250 100 Plus
X 23527363 X 16284694..16284924 248..478 1155 100 Plus
3R 31820162 3R 20489317..20489850 679..146 1080 80.1 Minus
2R 25260384 2R 24502993..24503187 476..282 390 80 Minus
2R 25260384 2R 24502652..24502813 637..476 330 80.2 Minus
2R 25260384 2R 24503283..24503374 250..159 250 84.7 Minus
3R 31820162 3R 20489180..20489228 816..768 170 89.7 Minus
Blast to na_te.dros performed on 2019-03-16 04:55:05 has no hits.

RE28175.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:55:58 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16165973..16166220 1..248 100 -> Plus
chrX 16166298..16166527 249..478 100 -> Plus
chrX 16166593..16167288 479..1174 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:51 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..750 147..896 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:51 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..750 147..896 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:44:56 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha4-RA 1..750 147..896 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:26 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..750 147..896 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:41 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha4-RA 1..750 147..896 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:01 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..1174 1..1174 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:51 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..1174 1..1174 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:44:56 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha4-RA 3..1176 1..1174 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:26 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Pros28.1-RA 1..1174 1..1174 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:41 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha4-RA 3..1176 1..1174 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:58 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
X 16276272..16276519 1..248 100 -> Plus
X 16276597..16276826 249..478 100 -> Plus
X 16276892..16277587 479..1174 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:58 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
X 16276272..16276519 1..248 100 -> Plus
X 16276597..16276826 249..478 100 -> Plus
X 16276892..16277587 479..1174 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:58 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
X 16276272..16276519 1..248 100 -> Plus
X 16276597..16276826 249..478 100 -> Plus
X 16276892..16277587 479..1174 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:44:56 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16170305..16170552 1..248 100 -> Plus
arm_X 16170630..16170859 249..478 100 -> Plus
arm_X 16170925..16171620 479..1174 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:42 Download gff for RE28175.complete
Subject Subject Range Query Range Percent Splice Strand
X 16284370..16284617 1..248 100 -> Plus
X 16284695..16284924 249..478 100 -> Plus
X 16284990..16285685 479..1174 100   Plus

RE28175.pep Sequence

Translation from 146 to 895

> RE28175.pep
MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKK
SVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNV
EDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTE
PSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEV
AQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK*

RE28175.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19028-PA 249 GF19028-PA 1..231 1..231 1128 90.5 Plus
Dana\GF11246-PA 252 GF11246-PA 1..246 1..245 866 64 Plus
Dana\GF17957-PA 234 GF17957-PA 3..233 2..234 402 37 Plus
Dana\GF13117-PA 243 GF13117-PA 6..239 3..231 342 33.8 Plus
Dana\GF15751-PA 285 GF15751-PA 5..245 3..246 321 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17945-PA 249 GG17945-PA 1..231 1..231 1187 95.2 Plus
Dere\GG15180-PA 251 GG15180-PA 1..248 1..248 1071 79 Plus
Dere\GG19922-PA 252 GG19922-PA 1..250 1..249 831 59.6 Plus
Dere\GG18927-PA 234 GG18927-PA 3..233 2..234 396 36.4 Plus
Dere\GG20675-PA 244 GG20675-PA 6..243 3..234 342 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12557-PA 249 GH12557-PA 1..234 1..234 1155 92.3 Plus
Dgri\GH20892-PA 254 GH20892-PA 1..249 1..248 707 52.2 Plus
Dgri\GH13898-PA 234 GH13898-PA 3..233 2..234 398 36.9 Plus
Dgri\GH21393-PA 245 GH21393-PA 6..220 3..213 349 35.3 Plus
Dgri\GH21325-PA 253 GH21325-PA 4..179 1..176 303 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha4-PA 249 CG3422-PA 1..249 1..249 1257 100 Plus
Prosalpha4T1-PA 249 CG17268-PA 1..249 1..249 958 75.1 Plus
Prosalpha4T2-PB 252 CG4569-PB 1..250 1..249 809 60.4 Plus
Prosalpha4T2-PA 252 CG4569-PA 1..250 1..249 809 60.4 Plus
Prosalpha2-PA 234 CG5266-PA 3..233 2..234 368 36.4 Plus
Prosalpha5-PB 244 CG10938-PB 6..243 3..234 335 33.6 Plus
Prosalpha5-PA 244 CG10938-PA 6..243 3..234 335 33.6 Plus
Prosalpha6-PA 279 CG4904-PA 4..245 3..240 318 30.2 Plus
Prosalpha6-PB 279 CG4904-PB 4..245 3..240 318 30.2 Plus
Prosalpha3-PA 264 CG9327-PA 1..255 1..249 294 29 Plus
Prosalpha6T-PA 289 CG5648-PA 4..236 3..235 293 32.2 Plus
Prosalpha3T-PA 251 CG1736-PA 1..176 1..176 288 33.5 Plus
Prosalpha7-PA 253 CG1519-PA 8..196 5..190 283 32.3 Plus
Prosalpha1-PB 244 CG18495-PB 6..244 2..237 277 29 Plus
Prosalpha1-PA 244 CG18495-PA 6..244 2..237 277 29 Plus
CG30382-PB 244 CG30382-PB 6..244 2..237 277 29 Plus
CG30382-PA 244 CG30382-PA 6..244 2..237 277 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11210-PA 249 GI11210-PA 1..234 1..234 1163 91.9 Plus
Dmoj\GI18902-PA 253 GI18902-PA 4..241 5..241 741 58 Plus
Dmoj\GI18257-PA 254 GI18257-PA 4..241 1..237 638 48.3 Plus
Dmoj\GI24829-PA 234 GI24829-PA 3..233 2..234 401 37.3 Plus
Dmoj\GI18573-PA 245 GI18573-PA 6..219 3..212 352 35 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21346-PA 185 GL21346-PA 1..179 35..213 871 89.9 Plus
Dper\GL20413-PA 252 GL20413-PA 1..246 1..245 797 58.1 Plus
Dper\GL26115-PA 219 GL26115-PA 1..219 1..249 769 62.6 Plus
Dper\GL27312-PA 234 GL27312-PA 3..233 2..234 394 36.2 Plus
Dper\GL11421-PA 244 GL11421-PA 6..241 3..232 333 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17441-PA 249 GA17441-PA 1..231 1..231 1129 90.5 Plus
Dpse\GA25292-PA 249 GA25292-PA 1..249 1..249 1109 81.1 Plus
Dpse\GA25111-PA 252 GA25111-PA 1..246 1..245 797 58.1 Plus
Dpse\GA18772-PA 234 GA18772-PA 3..233 2..234 394 36.2 Plus
Dpse\GA10654-PA 244 GA10654-PA 6..241 3..232 333 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Pros28.1A-PA 251 GM23164-PA 1..248 1..248 1025 76.2 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 1..250 1..249 859 61.2 Plus
Dsec\GM24033-PA 234 GM24033-PA 3..233 2..234 392 36.4 Plus
Dsec\GM21770-PA 244 GM21770-PA 6..243 3..234 361 34.9 Plus
Dsec\GM18005-PA 281 GM18005-PA 4..240 3..233 327 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Pros28.1A-PA 251 GD20037-PA 1..248 1..248 1026 76.2 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 1..250 1..249 855 61.2 Plus
Dsim\GD18834-PA 234 GD18834-PA 3..233 2..234 392 36.4 Plus
Dsim\GD11263-PA 244 GD11263-PA 6..243 3..234 359 34.9 Plus
Dsim\GD23664-PA 281 GD23664-PA 4..240 3..233 327 30.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Pros28.1-PA 249 GJ18504-PA 1..234 1..234 1156 92.3 Plus
Dvir\GJ20726-PA 251 GJ20726-PA 1..248 1..248 770 57 Plus
Dvir\Pros28.1B-PA 251 GJ19357-PA 2..248 3..248 696 51.8 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 3..233 2..234 400 37.3 Plus
Dvir\GJ20367-PA 245 GJ20367-PA 6..220 3..213 342 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25669-PA 249 GK25669-PA 1..234 1..234 1165 91.9 Plus
Dwil\GK19681-PA 255 GK19681-PA 1..248 1..247 797 59.3 Plus
Dwil\GK14404-PA 234 GK14404-PA 3..233 2..234 377 35.6 Plus
Dwil\GK21413-PA 245 GK21413-PA 6..221 3..213 343 35.2 Plus
Dwil\GK22956-PA 262 GK22956-PA 1..240 1..236 301 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17253-PA 249 GE17253-PA 1..231 1..231 1181 95.2 Plus
Dyak\GE25043-PA 251 GE25043-PA 1..248 1..248 1049 77.8 Plus
Dyak\GE11446-PA 252 GE11446-PA 1..250 1..249 847 61 Plus
Dyak\GE26194-PA 234 GE26194-PA 3..233 2..234 390 36 Plus
Dyak\ProsMA5-PA 244 GE11658-PA 6..243 3..234 344 33.6 Plus

RE28175.hyp Sequence

Translation from 146 to 895

> RE28175.hyp
MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKK
SVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNV
EDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTE
PSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEV
AQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK*

RE28175.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha4-PA 249 CG3422-PA 1..249 1..249 1257 100 Plus
Prosalpha4T1-PA 249 CG17268-PA 1..249 1..249 958 75.1 Plus
Prosalpha4T2-PB 252 CG4569-PB 1..250 1..249 809 60.4 Plus
Prosalpha4T2-PA 252 CG4569-PA 1..250 1..249 809 60.4 Plus
Prosalpha2-PA 234 CG5266-PA 3..233 2..234 368 36.4 Plus