Clone RE28342 Report

Search the DGRC for RE28342

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:283
Well:42
Vector:pFlc-1
Associated Gene/Transcriptbou-RA
Protein status:RE28342.pep: gold
Preliminary Size:450
Sequenced Size:714

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14430 2001-12-14 Blastp of sequenced clone
CG14430 2002-01-01 Sim4 clustering to Release 2
CG14430 2003-01-01 Sim4 clustering to Release 3
CG14430 2008-04-29 Release 5.5 accounting
CG14430 2008-08-15 Release 5.9 accounting
CG14430 2008-12-18 5.12 accounting

Clone Sequence Records

RE28342.complete Sequence

714 bp (714 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071242

> RE28342.complete
TGAGTATAAACTTGGCATTTGCTGACGACGCTGACTGTTTGATTTACCTA
GAGTAGAGAATCGTAAAACGTACTGCTGTGACGTAATCATGTGGCCGCCC
AAGCACGCCCACATTGGCTGGCTTTCAAGCCTTGCTCTCGTCGTTCTCCT
GATGAGCCTGCAAATGGTAATGGTATCGGGGATCGAGTGCTACGTGTGCG
ACACGAGCGATACGGAGCATCCGTTCCAGTGCGGCGAGTGGTTCGAGCGA
TACGACATACCGGACATTCAACCCCAAAATTGTTCCAGTGTCCATGGCGC
CCAGTTCTGTGTGAAGCACGTGGGTCGTTTTGAGGGTGGAATCGGGGCGA
AGAGGTTCTGCAGTTCGAAGGACATGGGCAACTATTGTGACTATGTGCGA
AACAAGGGCGATCGCATGGACTATCGCAGCTGCATTTACACTTGTGATAC
GGACGGTTGCAATGCCGCTGGAAGGCTGGAACTGGAATGGGGCGTGGCAG
CGGCCCTCCTCACTCTCACATGGCTCTTACGGCACTGACAGCATCGGGCG
GATAGATATAAGTGACGAAAGAGCTGCATCGCTACATTAATTTTTTTTCG
TTAATTATAAGTTGTAACAAAGTAACTGACACACAAAACAGACACTCTAG
TATAGGTAAAAACGAAAACCAAAAACAAAAATATATAAACAAATACGGAA
AAAAAAAAAAAAAA

RE28342.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
bou-RA 714 bou-RA 4..708 3..707 3510 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6878646..6879341 3..698 3480 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6986493..6987197 3..707 3510 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6994591..6995295 3..707 3510 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 19:01:03 has no hits.

RE28342.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:02 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6878643..6879341 1..698 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:08 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
CG14430-RA 1..450 89..538 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:21 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 1..450 89..538 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:57 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 1..450 89..538 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:28 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
CG14430-RA 1..450 89..538 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:33 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 1..450 89..538 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:33 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
CG14430-RA 1..699 1..698 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:21 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 1..699 1..698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:57 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 4..702 1..698 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:28 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
CG14430-RA 1..699 1..698 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:33 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
bou-RA 5..703 1..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:02 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
X 6986490..6987188 1..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:02 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
X 6986490..6987188 1..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:02 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
X 6986490..6987188 1..698 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:57 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6880523..6881221 1..698 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:09 Download gff for RE28342.complete
Subject Subject Range Query Range Percent Splice Strand
X 6994588..6995286 1..698 99   Plus

RE28342.pep Sequence

Translation from 88 to 537

> RE28342.pep
MWPPKHAHIGWLSSLALVVLLMSLQMVMVSGIECYVCDTSDTEHPFQCGE
WFERYDIPDIQPQNCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYC
DYVRNKGDRMDYRSCIYTCDTDGCNAAGRLELEWGVAAALLTLTWLLRH*

RE28342.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20356-PA 159 GF20356-PA 30..159 26..149 567 83.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19625-PA 148 GG19625-PA 1..148 1..149 761 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24685-PA 147 GH24685-PA 26..132 32..137 504 86 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
bou-PA 149 CG14430-PA 1..149 1..149 839 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21667-PA 148 GI21667-PA 28..143 32..144 527 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26819-PA 151 GL26819-PA 28..148 32..147 526 82 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12978-PA 151 GA12978-PA 28..148 32..147 526 82 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17496-PA 149 GM17496-PA 1..149 1..149 797 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16825-PA 149 GD16825-PA 1..149 1..149 801 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15792-PA 142 GJ15792-PA 22..135 31..143 530 86 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18854-PA 147 GK18854-PA 12..144 16..143 507 69.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15693-PA 149 GE15693-PA 1..149 1..149 783 97.3 Plus

RE28342.hyp Sequence

Translation from 88 to 537

> RE28342.hyp
MWPPKHAHIGWLSSLALVVLLMSLQMVMVSGIECYVCDTSDTEHPFQCGE
WFERYDIPDIQPQNCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYC
DYVRNKGDRMDYRSCIYTCDTDGCNAAGRLELEWGVAAALLTLTWLLRH*

RE28342.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
bou-PA 149 CG14430-PA 1..149 1..149 839 100 Plus