Clone RE28480 Report

Search the DGRC for RE28480

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:284
Well:80
Vector:pFlc-1
Associated Gene/TranscriptRpS11-RC
Protein status:RE28480.pep: gold
Sequenced Size:743

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpS11-RA 2008-12-09 Manual selection by Sue Celniker

Clone Sequence Records

RE28480.complete Sequence

743 bp assembled on 2009-05-29

GenBank Submission: BT088759.1

> RE28480.complete
CTTTCCTTTTTCATCAACATGGCTGATCAGAACGAGCGCGCCTTCCAAAA
ACAATTCGGTGTCAACCTAAACCGCAAGGTCAAGCCCGGTATCACCAAGA
AGAAGCTGCTGCGTCGCTCCCGCGATGTGGGACTCGGTTTCAAGACCCCA
CGTGAGGCCATCGATGGTACCTACATCGACAAGAAGTGCCCCTGGACCGG
TGATGTGAGGATCCGTGGTCGCATTCTGACCGGCGTGGTCCGCAAGGCCA
AGATGCAGCGCACCATTGTCATTCGGCGCGACTACCTGCACTTTGTGCGC
AAATACAGCCGTTTCGAGAAGCGTCACCGCAACATGAGCGTCCACTGCTC
CCCTGTGTTCAGAGATGTTGAGCATGGCGATATTGTCACCATTGGTGAGT
GCCGTCCTCTGTCCAAGACTGTGCGCTTCAACGTCCTGAAAGTCAGCAAG
GGTCAGGGAGCCAAGAAGAGCTTCAAGAAGTACTAGAGCGGACAACTACC
ATTCGGGCGATAATATTTGTAGCAATTATTCTTTTTGAATAAAACAAAAA
AAAGTAACTTTAACCATGGGTTTTCTCCAGTTCTTCTCTCAGTTTCCACA
GCATTTCAGCAGTCGTGCAGCCAGCTATTCCATTAAAAGAAACTAAAGAT
GACCGCAAGAATATGGACACGAATTGCATTGAATGTACATTATTAATATG
ATTTTCTTAAATAAAAGTTGATTGATCAAAAAAAAAAAAAAAA

RE28480.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RC 894 RpS11-RC 162..887 1..726 3630 100 Plus
RpS11.b 772 RpS11.b 43..766 1..726 3575 99.7 Plus
RpS11.a 897 RpS11.a 194..891 29..726 3490 100 Plus
RpS11.a 897 RpS11.a 43..72 1..30 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8086529..8086808 639..360 1400 100 Minus
chr2R 21145070 chr2R 8087050..8087257 362..155 1040 100 Minus
chr2R 21145070 chr2R 8087331..8087460 157..28 650 100 Minus
chr2R 21145070 chr2R 8086241..8086329 726..638 445 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12199313..12199592 639..360 1400 100 Minus
2R 25286936 2R 12199834..12200041 362..155 1040 100 Minus
2R 25286936 2R 12200115..12200244 157..28 650 100 Minus
2R 25286936 2R 12199025..12199113 726..638 445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12200512..12200791 639..360 1400 100 Minus
2R 25260384 2R 12201033..12201240 362..155 1040 100 Minus
2R 25260384 2R 12201314..12201443 157..28 650 100 Minus
2R 25260384 2R 12200224..12200312 726..638 445 100 Minus
2R 25260384 2R 12201974..12202003 30..1 150 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:34:09 has no hits.

RE28480.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:35:14 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8087050..8087255 157..362 100 <- Minus
chr2R 8087332..8087457 31..156 100 <- Minus
chr2R 8087991..8088020 1..30 100   Minus
chr2R 8086529..8086805 363..639 100 <- Minus
chr2R 8086240..8086327 640..727 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:50 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RA 1..468 19..486 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:45 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 1..468 19..486 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:31 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 1..468 19..486 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:57 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 1..468 19..486 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-29 16:12:10 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RA 25..750 1..727 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:45 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 25..750 1..727 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:31 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 12..737 1..727 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:57 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 12..737 1..727 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:14 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12199024..12199111 640..727 98 <- Minus
2R 12199313..12199589 363..639 100 <- Minus
2R 12199834..12200039 157..362 100 <- Minus
2R 12200116..12200241 31..156 100 <- Minus
2R 12200775..12200804 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:14 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12199024..12199111 640..727 98 <- Minus
2R 12199313..12199589 363..639 100 <- Minus
2R 12199834..12200039 157..362 100 <- Minus
2R 12200116..12200241 31..156 100 <- Minus
2R 12200775..12200804 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:14 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12199024..12199111 640..727 98 <- Minus
2R 12199313..12199589 363..639 100 <- Minus
2R 12199834..12200039 157..362 100 <- Minus
2R 12200116..12200241 31..156 100 <- Minus
2R 12200775..12200804 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:31 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8086529..8086616 640..727 98 <- Minus
arm_2R 8086818..8087094 363..639 100 <- Minus
arm_2R 8087339..8087544 157..362 100 <- Minus
arm_2R 8087621..8087746 31..156 100 <- Minus
arm_2R 8088280..8088309 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:07 Download gff for RE28480.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12200512..12200788 363..639 100 <- Minus
2R 12201033..12201238 157..362 100 <- Minus
2R 12201315..12201440 31..156 100 <- Minus
2R 12201974..12202003 1..30 100   Minus
2R 12200223..12200310 640..727 98 <- Minus

RE28480.hyp Sequence

Translation from 0 to 485

> RE28480.hyp
LSFFINMADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTP
REAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVR
KYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSK
GQGAKKSFKKY*

RE28480.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PC 155 CG8857-PC 1..155 7..161 812 100 Plus
RpS11-PB 154 CG8857-PB 1..154 7..161 660 83.3 Plus

RE28480.pep Sequence

Translation from 0 to 485

> RE28480.pep
LSFFINMADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTP
REAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVR
KYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSK
GQGAKKSFKKY*

RE28480.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12077-PA 196 GF12077-PA 45..196 10..161 772 96.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22596-PA 196 GG22596-PA 45..196 10..161 792 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22980-PA 196 GH22980-PA 45..196 10..161 771 96.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PC 155 CG8857-PC 1..155 7..161 812 100 Plus
RpS11-PB 154 CG8857-PB 1..154 7..161 660 83.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18949-PA 196 GI18949-PA 42..196 7..161 769 94.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11264-PA 196 GL11264-PA 45..196 10..161 761 94.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21371-PA 196 GA21371-PA 45..196 10..161 761 94.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20375-PA 196 GM20375-PA 45..196 10..161 793 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15239-PA 196 GD15239-PA 45..196 10..161 792 99.3 Plus
Dsim\GD25853-PA 115 GD25853-PA 1..115 47..161 583 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21555-PA 196 GJ21555-PA 42..196 7..161 765 92.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22117-PA 196 GK22117-PA 45..196 10..161 761 94.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13464-PA 196 GE13464-PA 45..196 10..161 792 99.3 Plus