Clone RE28524 Report

Search the DGRC for RE28524

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:285
Well:24
Vector:pFlc-1
Associated Gene/TranscriptmRpS17-RA
Protein status:RE28524.pep: gold
Preliminary Size:684
Sequenced Size:723

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4326 2002-01-01 Sim4 clustering to Release 2
CG4326 2002-02-22 Blastp of sequenced clone
CG4326 2003-01-01 Sim4 clustering to Release 3
mRpS17 2008-04-29 Release 5.5 accounting
mRpS17 2008-08-15 Release 5.9 accounting
mRpS17 2008-12-18 5.12 accounting

Clone Sequence Records

RE28524.complete Sequence

723 bp (723 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084147

> RE28524.complete
AGTGATCTACCAGCTGTGTTTCCCAACCGGTTGTTTATTTTTCTAAACTC
TTAAATTAAATTAAAGTAATGTCGAGGCGAGGACTCCTACTAATGGGCCA
GTGCATGCCCTGCATCAAGCAGAACGCCTCCAAGATCCGCATTCGCCGAA
TGGAGCTGGACAAGAACCTGAATATGTACTTTAAGAAGGACGAGTTCTAC
TTCGCCCACGATCCGCAGAAGGTGTGCAAGACCGGGGACGTGGTCCTGAT
ACGGGAACTGCCAGAGCGCCTCACCCGCCTCATCACGCACAACGTGGAAA
AAGTGGTCTATCCGCTGGGTGACATAACGGACCCGCTCACTGGCAAGAAG
GTGGTCGTGGGCAATTACCGCGAGGACATCGAGATGGCCAACCAGCTGTT
CGGCAAGTCAGAGAAGGCCTTCGACTACGAGAAGGCACCGCCCCGCGGTC
GCCTGGAGGGAACCAAGGACTTCACCCACGGGGAAACATACATCAAGTAC
CACGAGGATGGCAAGGATCAGCCGTTCGCCGTTTAGAGCTCTGCCGGTCG
TTTATCTGTTAAGTTTCCCCTTTGTTTAATAGTAAAGTGCATTAATATGA
CGTACATATGTTTCTCGGTTTTCTTATAAAATGGTTAGGCCGACGAAAGA
AGATATTTTTATAGGTTTTTGATTGCTTGAATTGAATTAAAAAGGCAGGT
TTAAAAGAAAAAAAAAAAAAAAA

RE28524.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS17-RA 724 mRpS17-RA 17..724 1..708 3540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20059681..20060212 707..176 2600 99.2 Minus
chr2R 21145070 chr2R 20060276..20060451 176..1 880 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24173664..24174196 708..176 2665 100 Minus
2R 25286936 2R 24174260..24174435 176..1 880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24174863..24175395 708..176 2665 100 Minus
2R 25260384 2R 24175459..24175634 176..1 880 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:14:00 has no hits.

RE28524.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:14:42 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20059681..20060211 177..707 99 <- Minus
chr2R 20060276..20060451 1..176 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:14 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:33 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:09:16 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:01 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:26 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:50 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..707 1..707 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:33 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 1..707 1..707 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:16 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 7..713 1..707 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:01 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 3..709 1..707 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:26 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS17-RA 7..713 1..707 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:42 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24173665..24174195 177..707 100 <- Minus
2R 24174260..24174435 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:42 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24173665..24174195 177..707 100 <- Minus
2R 24174260..24174435 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:42 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24173665..24174195 177..707 100 <- Minus
2R 24174260..24174435 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:16 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20061188..20061718 177..707 100 <- Minus
arm_2R 20061783..20061958 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:34 Download gff for RE28524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24174882..24175412 177..707 100 <- Minus
2R 24175477..24175652 1..176 100   Minus

RE28524.hyp Sequence

Translation from 68 to 535

> RE28524.hyp
MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQ
KVCKTGDVVLIRELPERLTRLITHNVEKVVYPLGDITDPLTGKKVVVGNY
REDIEMANQLFGKSEKAFDYEKAPPRGRLEGTKDFTHGETYIKYHEDGKD
QPFAV*

RE28524.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS17-PA 155 CG4326-PA 1..155 1..155 824 100 Plus

RE28524.pep Sequence

Translation from 68 to 535

> RE28524.pep
MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQ
KVCKTGDVVLIRELPERLTRLITHNVEKVVYPLGDITDPLTGKKVVVGNY
REDIEMANQLFGKSEKAFDYEKAPPRGRLEGTKDFTHGETYIKYHEDGKD
QPFAV*

RE28524.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13471-PA 155 GF13471-PA 1..155 1..155 796 95.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19946-PA 155 GG19946-PA 1..155 1..155 808 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21909-PA 155 GH21909-PA 1..155 1..155 779 92.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS17-PA 155 CG4326-PA 1..155 1..155 824 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19260-PA 155 GI19260-PA 1..155 1..155 776 91.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17109-PA 155 GL17109-PA 1..155 1..155 792 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18111-PA 155 GA18111-PA 1..155 1..155 792 94.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18264-PA 155 GM18264-PA 1..155 1..155 817 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24969-PA 155 GD24969-PA 1..155 1..155 817 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22135-PA 155 GJ22135-PA 1..155 1..155 777 92.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23193-PA 155 GK23193-PA 1..155 1..155 798 96.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11475-PA 155 GE11475-PA 1..155 1..155 822 99.4 Plus