Clone RE28551 Report

Search the DGRC for RE28551

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:285
Well:51
Vector:pFlc-1
Associated Gene/Transcriptgrim-RA
Protein status:RE28551.pep: gold
Preliminary Size:417
Sequenced Size:1713

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4345 2002-01-01 Sim4 clustering to Release 2
CG4345 2003-01-01 Sim4 clustering to Release 3
CG4345 2003-02-11 Blastp of sequenced clone
grim 2008-04-29 Release 5.5 accounting
grim 2008-08-15 Release 5.9 accounting
grim 2008-12-18 5.12 accounting

Clone Sequence Records

RE28551.complete Sequence

1713 bp (1713 high quality bases) assembled on 2003-02-11

GenBank Submission: BT003512

> RE28551.complete
GGCAGTCCACTCTGAAACCTCGACGAGAGAACATTGAATAACAAGCGGAA
GCGAAAAGCGCAGTTGAAAGTTCGTCAAAAAGCGACAAGTTTCCTCGTTC
GTTTTCCCGCCAAATGAGTCAGAAAAATTTTCCAAGTGCTCGATACGAAA
CATAAAGACTTACAAGACTTAAAGTGCAAGCAGTGAATGGAATATATTAT
TCCTCAGCGATATTGAAATCAAACATTAAAAATATATGCTACACTAAAGT
TATATATTTTTTTAAAGATTCATACGTTTTGTAAAATCACATTTTGTATT
AAATTAAATACCGCCATGGCCATCGCCTATTTCATACCCGACCAGGCCCA
ATTGTTGGCCAGAAGCTATCAGCAAAACGGCCAGCAGACAGCAGCGAGTC
CAAGGACAACTGCAACAGCTGCTGCACCATCGCAGCAGCAGCAACAATCG
CAACAACAGCAGCAGCAGCAGCGACATCATCATCAGCAACAGCGCCCACA
ATTCCGTGCCAATATTTCCGTGCCGCTGGGAAGTCAACAGGGATCGATGA
CCATGTCGGAGTTTGGATGCTGGGATCTTTTGGCCCAGATCTTCTGCTAC
GCTCTGCGAATCTACAGCTACAGTTCGAGCCAGCGTCAACCGACGGTCAT
TCAGATATCCTTCGAGATCAGCAGCGGCGGTCAGAACAACGATGAGGACG
ACGTGACTGATGCCACCTCCAAGGAGAACTAAATTTGGTTTCCATATTTC
ATCCTGGTGGAGAGAAAATCTTTGGGATTTTCTGGGAAAGGCAGGCTCAA
TCAAAGCGCATTGTGATTTCTTTTTTGGGTATGGACACATGAGGAGGAAC
GAGTTTTGTAAAACATGGGATATTTCCACAACAAAATAAGAAAACTATTT
TTAAACTATTTTTGAGAGAGAGAAAATTCAAAATTTGTCATCGACTTGCT
TAAAGTGATTTTGGTTGTTTGTTACTTTTTTGGATGTCAAATTTTCCGAT
ATAAGTTTTGAAAAAAATGTTTAATTTTGCAAGCAAAGGTTTCCCGGTTG
GTTCAAATACATAAACATACTTAACAACATTTAGAGAGCATAAAGAGAAA
TGTGTAAAATTGTCATAAACCTTATTAGTGTCTATACGTATGAGCAAAAC
CACAAGTATCGTACTCAACTAACAAATAATTGTCAAATTTTCTACTTCAA
CTACTTCAACTACATTTCAACTACTTACAAATATAAATCGTAAACTAATA
TTACAGAACTACAATACAGAACCAACAACAAAACAAAGATGCAACCGCAG
CAACAAGAATAACAAAAGACAACAACTCAATTGTACAAAATAGATTTTAA
GCAAACAGCAAATTTTATATGTTTACAACAAAGGGAGAAAATACAAAACG
TCTACAAAAAATAGAATACAAGAACCGCCGAACAGAATACATTTTAACAA
AAATTAAACAAAACAACAACAAACATTTAAGCAATTTTGATACGAATAAT
CAAGAATAACAAAATTTGAAATGTATCTTATCATTATTATTGATTTTAGC
AAAATTCAAAACATATTATTTTAATTTTGGCATTGCAAATTAAACAAGAA
ATATTGAAATTAATCACATGTAAAGATAGCATTTGTAAGAAATTAAAATT
TTTATAAGACAAACAAGCAAAAAATAAATACAATTTTATAAAAAATTAAA
AAAAAAAAAAAAA

RE28551.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
grim-RA 1696 grim-RA 3..1696 3..1697 8420 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18292343..18293996 1697..3 7635 97.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:46:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18302713..18304412 1703..3 8440 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18295813..18297512 1703..3 8450 99.8 Minus
Blast to na_te.dros performed 2019-03-16 13:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 489..1085 1068..1665 252 55.4 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 771..1067 1396..1694 247 58.8 Plus
rover 7318 rover ROVER 7318bp 639..1083 1053..1513 214 56.4 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1033..1330 1611..1308 163 54.7 Minus
rover 7318 rover ROVER 7318bp 790..1142 1053..1411 141 56 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 343..609 1374..1634 139 53.4 Plus
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 3038..3207 1166..1327 139 56.7 Plus
gypsy10 6006 gypsy10 GYPSY10 6006bp 703..888 1367..1555 137 55.7 Plus
412 7567 412 412 7567bp 3914..4053 162..302 134 57.7 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 94..199 1697..1591 127 58.9 Minus
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 164..220 248..192 123 68.4 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 4543..4581 1572..1534 114 76.9 Minus

RE28551.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:00:49 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18292373..18292813 1227..1667 99 == Minus
chr3L 18292830..18293531 489..1191 99 == Minus
chr3L 18293618..18293998 1..381 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:16 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..417 316..732 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:53:09 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..417 316..732 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:44:13 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..417 316..732 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:44:16 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..417 316..732 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:08:11 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..417 316..732 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:07:28 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..1696 2..1697 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:53:09 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..1696 2..1697 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:44:13 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 4..1699 1..1697 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:44:16 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 1..1696 2..1697 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:08:11 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
grim-RA 4..1699 1..1697 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:00:49 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18302719..18304414 1..1697 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:00:49 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18302719..18304414 1..1697 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:00:49 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18302719..18304414 1..1697 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:44:13 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18295819..18297514 1..1697 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:15:08 Download gff for RE28551.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18295819..18297514 1..1697 99   Minus

RE28551.pep Sequence

Translation from 315 to 731

> RE28551.pep
MAIAYFIPDQAQLLARSYQQNGQQTAASPRTTATAAAPSQQQQQSQQQQQ
QQRHHHQQQRPQFRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIY
SYSSSQRQPTVIQISFEISSGGQNNDEDDVTDATSKEN*

RE28551.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10822-PA 128 GF10822-PA 1..128 1..138 412 71.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15746-PA 140 GG15746-PA 1..140 1..138 512 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22247-PA 156 GH22247-PA 1..125 1..126 352 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
grim-PA 138 CG4345-PA 1..138 1..138 710 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11722-PA 151 GI11722-PA 1..128 1..122 324 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22714-PA 158 GL22714-PA 1..158 1..138 354 55.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18123-PA 150 GA18123-PA 1..150 1..138 338 57.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14945-PA 136 GM14945-PA 1..136 1..138 664 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12347-PA 136 GD12347-PA 1..136 1..138 663 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11395-PA 150 GJ11395-PA 1..147 1..136 383 61.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11571-PA 150 GK11571-PA 1..141 1..132 346 57 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22078-PA 142 GE22078-PA 1..142 1..138 508 88 Plus

RE28551.hyp Sequence

Translation from 315 to 731

> RE28551.hyp
MAIAYFIPDQAQLLARSYQQNGQQTAASPRTTATAAAPSQQQQQSQQQQQ
QQRHHHQQQRPQFRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIY
SYSSSQRQPTVIQISFEISSGGQNNDEDDVTDATSKEN*

RE28551.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
grim-PA 138 CG4345-PA 1..138 1..138 710 100 Plus