Clone RE28586 Report

Search the DGRC for RE28586

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:285
Well:86
Vector:pFlc-1
Associated Gene/TranscriptCG14806-RA
Protein status:RE28586.pep: gold
Sequenced Size:755

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14806-RA 2009-01-21 est gleaning
CG14806 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RE28586.complete Sequence

755 bp assembled on 2009-08-28

GenBank Submission: BT099656.1

> RE28586.complete
GATAACCGAAAAATGAACAAATGTTTTAGGTGCCAGCCCCGGATATCGCT
TTTCCAGTTCAGCCTACCGCGGTGCTATGCCGCAGTGCAGCCGGGATGTC
CACCGCCACAAGAAAAACCCGTCGTCGGTTTGCCACACAAGCCCGATCCC
AAGACGGTGAAGTGCGACTATATAGGACCGCCAGACGCGCAATCAAACCT
ACGTCCGTACGTACGGCACTACGGCGATGAGGAGACGCGGCTGGCAAGAA
GCCTGCGTCTTAAGCGGATCGAGGTGGAGGCATGGAACACGGACTTCTGG
ACAAAACACAATAAGCGCTTCTACGAGGAAAAGGAAGACTTCATCCGCCT
GCACAAGGAAAGCGGAACCAGCGAAGTGTCCGCGGACCAGATGAGCCACT
TCTACAAAGCGTTCCTCGACAAGAACTGGCGCATCCACATCATGTACAAC
ATCTCCTGGTACCTGAAGAACTTCGACATACTCACCCTGGCTGCCGCAGT
CCAGCTCCAGAGGCTTCTGGCGCTGGCCAAGCGAAGATCTTAGGTGCAAT
ATCTGTCGTCCCCATTTCGTAATTTCCAGTTTGCCGTTTGCAATAAGTTG
GAATAAAAGATCACGTGCGTAAAATGGTGGCATAAAATTTACTTAGCTAC
TATTTAAGGGGATGAAAAATACACGTTGTTCGGAGTTAGTTAATGTACTT
AAAAGTAATCGCAAACTATTTAAATAAAATAAAATAGAAGAAAAAAAAAA
AAAAA

RE28586.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14806-RA 1083 CG14806-RA 289..1027 2..740 3695 100 Plus
trr-RD 8308 trr-RD 8097..8308 740..529 1060 100 Minus
trr-RC 8358 trr-RC 8147..8358 740..529 1060 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1774861..1775275 326..740 2075 100 Plus
chrX 22417052 chrX 1774526..1774790 64..328 1325 100 Plus
chrX 22417052 chrX 1774405..1774466 2..63 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1881018..1881432 326..740 2075 100 Plus
X 23542271 X 1880683..1880947 64..328 1325 100 Plus
X 23542271 X 1880562..1880623 2..63 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1889116..1889530 326..740 2075 100 Plus
X 23527363 X 1888781..1889045 64..328 1325 100 Plus
X 23527363 X 1888660..1888721 2..63 310 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:44:49 has no hits.

RE28586.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:45:28 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1774404..1774466 1..63 98 -> Plus
chrX 1774526..1774789 64..327 100 -> Plus
chrX 1774863..1775275 328..740 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:56 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 1..531 13..543 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:49 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 1..531 13..543 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:46:12 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 1..531 13..543 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:40 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 1..531 13..543 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-28 09:27:33 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 265..1004 1..740 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:49 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 265..1004 1..740 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:46:12 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 280..1019 1..740 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:40 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
CG14806-RA 280..1019 1..740 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:28 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
X 1880683..1880946 64..327 100 -> Plus
X 1880561..1880623 1..63 98 -> Plus
X 1881020..1881432 328..740 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:28 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
X 1880683..1880946 64..327 100 -> Plus
X 1880561..1880623 1..63 98 -> Plus
X 1881020..1881432 328..740 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:28 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
X 1880683..1880946 64..327 100 -> Plus
X 1880561..1880623 1..63 98 -> Plus
X 1881020..1881432 328..740 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:46:12 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1774594..1774656 1..63 98 -> Plus
arm_X 1774716..1774979 64..327 100 -> Plus
arm_X 1775053..1775465 328..740 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:56 Download gff for RE28586.complete
Subject Subject Range Query Range Percent Splice Strand
X 1888781..1889044 64..327 100 -> Plus
X 1889118..1889530 328..740 100   Plus
X 1888659..1888721 1..63 98 -> Plus

RE28586.pep Sequence

Translation from 0 to 542

> RE28586.pep
DNRKMNKCFRCQPRISLFQFSLPRCYAAVQPGCPPPQEKPVVGLPHKPDP
KTVKCDYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWNTDFW
TKHNKRFYEEKEDFIRLHKESGTSEVSADQMSHFYKAFLDKNWRIHIMYN
ISWYLKNFDILTLAAAVQLQRLLALAKRRS*

RE28586.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19449-PA 188 GF19449-PA 1..183 5..180 739 77.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12888-PA 176 GG12888-PA 1..176 5..180 915 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17671-PA 181 GH17671-PA 1..172 5..173 541 60.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14806-PB 176 CG14806-PB 1..176 5..180 960 100 Plus
CG14806-PA 176 CG14806-PA 1..176 5..180 960 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21489-PA 84 GI21489-PA 2..84 98..180 339 73.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18213-PA 172 GL18213-PA 2..170 8..180 663 71.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13262-PA 172 GA13262-PA 2..170 8..180 663 71.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19176-PA 176 GM19176-PA 1..176 5..180 953 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16575-PA 176 GD16575-PA 1..176 5..180 949 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19030-PA 84 GJ19030-PA 2..84 98..180 330 72.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19240-PA 54 GK19240-PA 1..48 131..178 183 68.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16221-PA 176 GE16221-PA 1..176 5..180 915 95.5 Plus

RE28586.hyp Sequence

Translation from 0 to 542

> RE28586.hyp
HNRKMNKCFRCQPRISLFQFSLPRCYAAVQPGCPPPQEKPVVGLPHKPDP
KTVKCDYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWNTDFW
TKHNKRFYEEKEDFIRLHKESGTSEVSADQMSHFYKAFLDKNWRIHIMYN
ISWYLKNFDILTLAAAVQLQRLLALAKRRS*

RE28586.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14806-PB 176 CG14806-PB 1..176 5..180 960 100 Plus
CG14806-PA 176 CG14806-PA 1..176 5..180 960 100 Plus