Clone RE28596 Report

Search the DGRC for RE28596

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:285
Well:96
Vector:pFlc-1
Associated Gene/TranscriptHmgZ-RA
Protein status:RE28596.pep: gold
Preliminary Size:1140
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17921 2002-01-01 Sim4 clustering to Release 2
CG17921 2002-04-26 Blastp of sequenced clone
CG17921 2003-01-01 Sim4 clustering to Release 3
HmgZ 2008-04-29 Release 5.5 accounting
HmgZ 2008-08-15 Release 5.9 accounting
HmgZ 2008-12-18 5.12 accounting

Clone Sequence Records

RE28596.complete Sequence

710 bp (710 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113439

> RE28596.complete
ATCTTGCAAAGGCAAAAGCTGTACTACGTACGCTCAAGCGACTGACTTGG
GCATTCAGTGCAAAGAAAATTTTATACAGTGAACAGAGCAGCAACTGAAC
CAAAATCGAGCAGATTTTACCGATTTGCTGCAATTAAAACGCAAATTACG
CGACTTTTTCGTACGGCTGCTTAAGTGCTCAGCCTTTATATATATTCCTC
GAGAGAAGTTAAATTAAACCAGAATAATGAGTGGAGATCGCCCGAAGCGT
CCCCTTTCCGCCTACATGCTGTGGCTCAACGAGACCCGCGAACAGATCAA
GAAGGATAATCCCGGCAGCAAGGTGACAGACATCGCCAAGCGGGGCGGAG
AACTCTGGCGCGGACTGAAGGATAAGACCGAGTGGGAGCAGAAGGCCATC
AAAATGAAGGAGGAGTACAACAAGGCGGTAAAGGAGTACGAGGCCAATGG
CGGCACCGATTCGGGAGCGCCCAAGAAGCGAAAGAAGGCGGCCGCCAAGC
CAGCCAAGAAGGCCAAGAAGAAAGAGTCCTCCGAGGAGGAGGAGGAGGAC
GAGAGCGAGTAGACACGGTTGCATCCATCGCAATGGGCAACGTTTTTCTG
CATAAGTTTTAAAATACATTTTATTAATGTAATTTTTTAAGTGACAAAAA
AAACCCACAAAATGAAAACCAAGAAAAAAACCTAATTAAAAACCAAAAAA
AAAAAAAAAA

RE28596.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
HmgZ-RB 1963 HmgZ-RB 749..1450 4..705 3510 100 Plus
HmgZ.a 1303 HmgZ.a 252..790 167..705 2695 100 Plus
HmgZ.d 1424 HmgZ.d 373..911 167..705 2695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17584479..17584794 694..380 1485 98.7 Minus
chr2R 21145070 chr2R 17584877..17585091 380..166 1075 100 Minus
chr2R 21145070 chr2R 17590786..17590948 166..4 800 99.4 Minus
chr2R 21145070 chr2R 17601986..17602105 257..376 195 77.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21697979..21698304 705..380 1630 100 Minus
2R 25286936 2R 21698387..21698601 380..166 1075 100 Minus
2R 25286936 2R 21704323..21704485 166..4 815 100 Minus
2R 25286936 2R 21715495..21715614 257..376 195 77.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21699178..21699503 705..380 1630 100 Minus
2R 25260384 2R 21699586..21699800 380..166 1075 100 Minus
2R 25260384 2R 21705522..21705684 166..4 815 100 Minus
2R 25260384 2R 21716694..21716813 257..376 195 77.5 Plus
Blast to na_te.dros performed 2019-03-16 21:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 6468..6518 596..647 122 75.5 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2001..2031 613..643 119 87.1 Plus

RE28596.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:07:32 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17584529..17584794 380..645 98 <- Minus
chr2R 17584878..17585090 167..379 100 <- Minus
chr2R 17590786..17590951 1..166 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:18 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RA 1..336 227..562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:18 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RA 1..336 227..562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:03 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 1..336 227..562 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:44 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RA 1..336 227..562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:27 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RA 1..336 227..562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:26 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 1..694 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:18 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 1..694 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:03 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 14..707 1..694 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:44 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 1..694 1..694 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:27 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
HmgZ-RB 14..707 1..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:32 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21697990..21698304 380..694 100 <- Minus
2R 21698388..21698600 167..379 100 <- Minus
2R 21704323..21704488 1..166 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:32 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21697990..21698304 380..694 100 <- Minus
2R 21698388..21698600 167..379 100 <- Minus
2R 21704323..21704488 1..166 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:32 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21697990..21698304 380..694 100 <- Minus
2R 21698388..21698600 167..379 100 <- Minus
2R 21704323..21704488 1..166 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:03 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17585495..17585809 380..694 100 <- Minus
arm_2R 17585893..17586105 167..379 100 <- Minus
arm_2R 17591828..17591993 1..166 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:15 Download gff for RE28596.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21699189..21699503 380..694 100 <- Minus
2R 21699587..21699799 167..379 100 <- Minus
2R 21705522..21705687 1..166 99   Minus

RE28596.pep Sequence

Translation from 226 to 561

> RE28596.pep
MSGDRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK
TEWEQKAIKMKEEYNKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKE
SSEEEEEDESE*

RE28596.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11622-PA 111 GF11622-PA 1..80 1..80 401 95 Plus
Dana\GF13265-PA 111 GF13265-PA 2..71 3..72 268 67.1 Plus
Dana\GF12460-PA 728 GF12460-PA 553..649 4..96 244 51.5 Plus
Dana\GF18856-PA 209 GF18856-PA 8..110 6..103 140 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20749-PA 111 GG20749-PA 1..111 1..111 550 100 Plus
Dere\GG22136-PA 111 GG22136-PA 3..78 4..79 301 69.7 Plus
Dere\GG19998-PA 724 GG19998-PA 552..628 5..79 235 57.1 Plus
Dere\GG11142-PA 138 GG11142-PA 3..78 1..73 165 40.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20784-PA 111 GH20784-PA 1..80 1..80 398 95 Plus
Dgri\GH21124-PA 111 GH21124-PA 3..78 4..79 300 69.7 Plus
Dgri\GH21151-PA 744 GH21151-PA 558..668 4..98 236 45 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
HmgZ-PD 111 CG17921-PD 1..111 1..111 579 100 Plus
HmgZ-PC 111 CG17921-PC 1..111 1..111 579 100 Plus
HmgZ-PA 111 CG17921-PA 1..111 1..111 579 100 Plus
HmgZ-PB 111 CG17921-PB 1..111 1..111 579 100 Plus
HmgD-PD 112 CG17950-PD 3..112 4..111 382 64.9 Plus
HmgD-PC 112 CG17950-PC 3..112 4..111 382 64.9 Plus
HmgD-PB 112 CG17950-PB 3..112 4..111 382 64.9 Plus
HmgD-PA 112 CG17950-PA 3..112 4..111 382 64.9 Plus
Ssrp-PA 723 CG4817-PA 554..661 5..107 269 46.3 Plus
tHMG1-PA 126 CG7045-PA 5..76 3..71 163 40.3 Plus
tHMG2-PA 133 CG7046-PA 5..78 3..73 162 39.2 Plus
tHMG2-PB 134 CG7046-PB 6..79 3..73 162 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20867-PA 111 GI20867-PA 1..80 1..80 400 95 Plus
Dmoj\GI18728-PA 112 GI18728-PA 2..71 3..72 269 68.6 Plus
Dmoj\GI18750-PA 734 GI18750-PA 559..660 4..96 254 51.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17523-PA 113 GL17523-PA 4..87 2..85 421 95.2 Plus
Dper\GL16947-PA 111 GL16947-PA 2..71 3..72 265 67.1 Plus
Dper\GL11071-PA 727 GL11071-PA 556..653 6..96 223 50 Plus
Dper\GL23184-PA 82 GL23184-PA 4..75 5..73 138 38.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14726-PA 113 GA14726-PA 4..87 2..85 421 95.2 Plus
Dpse\GA30453-PC 111 GA30453-PC 2..71 3..72 265 67.1 Plus
Dpse\GA30453-PB 111 GA30453-PB 2..71 3..72 265 67.1 Plus
Dpse\GA30453-PA 111 GA30453-PA 2..71 3..72 265 67.1 Plus
Dpse\GA18454-PA 727 GA18454-PA 556..653 6..96 223 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15692-PA 111 GM15692-PA 1..111 1..111 550 100 Plus
Dsec\GM15859-PA 112 GM15859-PA 2..71 3..72 274 70 Plus
Dsec\GM13209-PA 111 GM13209-PA 4..71 5..72 250 67.6 Plus
Dsec\GM26441-PA 137 GM26441-PA 4..69 2..64 145 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25171-PA 111 GD25171-PA 1..111 1..111 550 100 Plus
Dsim\GD11622-PA 112 GD11622-PA 2..71 3..72 274 70 Plus
Dsim\GD25013-PA 689 GD25013-PA 524..596 8..78 206 54.8 Plus
Dsim\GD20959-PA 137 GD20959-PA 4..76 2..71 143 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20604-PA 111 GJ20604-PA 1..80 1..80 405 96.2 Plus
Dvir\GJ21748-PA 112 GJ21748-PA 3..80 4..81 303 67.9 Plus
Dvir\GJ21774-PA 729 GJ21774-PA 557..678 4..111 247 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15658-PA 112 GK15658-PA 1..89 1..89 437 95.5 Plus
Dwil\GK15924-PA 111 GK15924-PA 3..88 4..87 304 66.3 Plus
Dwil\GK22092-PA 730 GK22092-PA 555..647 6..96 248 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HmgZ-PA 111 GE13680-PA 1..111 1..111 550 100 Plus
Dyak\HmgD-PA 111 GE12217-PA 3..78 4..79 301 69.7 Plus
Dyak\GE11532-PA 726 GE11532-PA 554..650 5..96 250 52.6 Plus
Dyak\GE10308-PA 138 GE10308-PA 4..78 2..73 172 44 Plus

RE28596.hyp Sequence

Translation from 226 to 561

> RE28596.hyp
MSGDRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK
TEWEQKAIKMKEEYNKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKE
SSEEEEEDESE*

RE28596.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
HmgZ-PD 111 CG17921-PD 1..111 1..111 579 100 Plus
HmgZ-PC 111 CG17921-PC 1..111 1..111 579 100 Plus
HmgZ-PA 111 CG17921-PA 1..111 1..111 579 100 Plus
HmgZ-PB 111 CG17921-PB 1..111 1..111 579 100 Plus
HmgD-PD 112 CG17950-PD 3..112 4..111 382 64.9 Plus