Clone RE28824 Report

Search the DGRC for RE28824

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:288
Well:24
Vector:pFlc-1
Associated Gene/TranscriptRpL12-RA
Protein status:RE28824.pep: gold
Preliminary Size:706
Sequenced Size:644

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3195 2001-12-14 Blastp of sequenced clone
CG3195 2002-01-01 Sim4 clustering to Release 2
CG3204 2003-01-01 Sim4 clustering to Release 3
RpL12 2008-04-29 Release 5.5 accounting
RpL12 2008-08-15 Release 5.9 accounting
RpL12 2008-12-18 5.12 accounting

Clone Sequence Records

RE28824.complete Sequence

644 bp (644 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071246

> RE28824.complete
AATAATCGATAGCTTCTTCTTTCTTTTTCTGTGTGTCTTTTTTGCGCGAC
TGTTCAAGCCAAGATACCGCTATGCCTCCCAAATTCGACCCAACGGAAGT
TAAATTGGTGTACCTGCGTTGCGTGGGCGGAGAAGTCGGTGCCACATCCT
CCCTGGCCCCAAAGATCGGTCCCCTCGGTCTGTCGCCCAAGAAAATCGGT
GATGACATCGCCAAGGCCACCTCCGACTGGAAGGGTCTGAAGATCACCGT
CTGCCTGACCATCCAGAACCGACAGGCCGCCATCTCCGTGGTTCCCTCCG
CCGCCTCGCTGATCATCAAGGCTCTGAAGGAACCCCCACGTGACCGCAAG
AAGCAGAAGAACATCAAGCACAGTGGAAACATTGGCTTCGAAGACATTCT
GGCCATCGCCCGCGTGATGAGGCCCAGGTCCATGGCCCGTGAGTTGAAGG
GAACCTGCAAGGAAGTTCTGGGAACCGCCCAGAGCGTCGGCTGCACCGTT
GACGGAAAGCACCCTCACGATGTTATTGACGAACTGAACGAGGGCTCCAT
TGAAGTCCCCGCGGAATAAACAGTTTTTTAAACAGAATTAATAAATTGTA
CGCGATACAGTCTGTAATAATTGACCCGAAAAAAAAAAAAAAAA

RE28824.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
RpL12-RA 1177 RpL12-RA 107..730 4..627 3120 100 Plus
RpL12-RB 939 RpL12-RB 147..728 46..627 2910 100 Plus
RpL12.b 1175 RpL12.b 147..728 46..627 2910 100 Plus
RpL12-RB 939 RpL12-RB 37..79 4..46 215 100 Plus
RpL12.b 1175 RpL12.b 37..79 4..46 215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19947173..19947436 364..627 1320 100 Plus
chr2R 21145070 chr2R 19946838..19947019 182..363 910 100 Plus
chr2R 21145070 chr2R 19946701..19946775 108..182 360 98.7 Plus
chr2R 21145070 chr2R 19946538..19946600 46..108 315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24061150..24061413 364..627 1320 100 Plus
2R 25286936 2R 24060812..24060993 182..363 910 100 Plus
2R 25286936 2R 24060675..24060749 108..182 375 100 Plus
2R 25286936 2R 24060512..24060574 46..108 315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24062349..24062612 364..627 1320 100 Plus
2R 25260384 2R 24062011..24062192 182..363 910 100 Plus
2R 25260384 2R 24061874..24061948 108..182 375 100 Plus
2R 25260384 2R 24061711..24061773 46..108 315 100 Plus
2R 25260384 2R 24061601..24061643 4..46 215 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:06:57 has no hits.

RE28824.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:07:36 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19946426..19946470 1..46 95 -> Plus
chr2R 19946539..19946600 47..108 100 -> Plus
chr2R 19946702..19946775 109..182 98 -> Plus
chr2R 19946839..19947019 183..363 100 -> Plus
chr2R 19947173..19947436 364..628 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:29 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 1..498 72..569 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:17 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 1..498 72..569 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:08 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RA 1..498 72..569 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:50 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 1..498 72..569 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:42 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RA 1..498 72..569 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:37 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 2..626 4..628 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:17 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 2..626 4..628 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:08 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RA 23..648 1..627 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:50 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RC 2..626 4..628 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:42 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
RpL12-RA 23..648 1..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:36 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24060400..24060444 1..46 95 -> Plus
2R 24060513..24060574 47..108 100 -> Plus
2R 24060676..24060749 109..182 100 -> Plus
2R 24060813..24060993 183..363 100 -> Plus
2R 24061150..24061413 364..628 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:36 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24060400..24060444 1..46 95 -> Plus
2R 24060513..24060574 47..108 100 -> Plus
2R 24060676..24060749 109..182 100 -> Plus
2R 24060813..24060993 183..363 100 -> Plus
2R 24061150..24061413 364..628 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:36 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24060400..24060444 1..46 95 -> Plus
2R 24060513..24060574 47..108 100 -> Plus
2R 24060676..24060749 109..182 100 -> Plus
2R 24060813..24060993 183..363 100 -> Plus
2R 24061150..24061413 364..628 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:08 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19948036..19948097 47..108 100 -> Plus
arm_2R 19948199..19948272 109..182 100 -> Plus
arm_2R 19948336..19948516 183..363 100 -> Plus
arm_2R 19948673..19948936 364..628 99   Plus
arm_2R 19947923..19947967 1..46 95 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:12 Download gff for RE28824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24062367..24062630 364..628 99   Plus
2R 24061617..24061661 1..46 95 -> Plus
2R 24061730..24061791 47..108 100 -> Plus
2R 24061893..24061966 109..182 100 -> Plus
2R 24062030..24062210 183..363 100 -> Plus

RE28824.hyp Sequence

Translation from 0 to 568

> RE28824.hyp
KSIASSFFFCVSFLRDCSSQDTAMPPKFDPTEVKLVYLRCVGGEVGATSS
LAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSA
ASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKG
TCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE*

RE28824.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpL12-PC 165 CG3195-PC 1..165 24..188 846 100 Plus
RpL12-PB 165 CG3195-PB 1..165 24..188 846 100 Plus
RpL12-PA 165 CG3195-PA 1..165 24..188 846 100 Plus

RE28824.pep Sequence

Translation from 71 to 568

> RE28824.pep
MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKAT
SDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKH
SGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHD
VIDELNEGSIEVPAE*

RE28824.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11364-PA 165 GF11364-PA 1..165 1..165 848 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22931-PA 165 GG22931-PA 1..165 1..165 857 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21709-PA 165 GH21709-PA 1..165 1..165 814 93.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL12-PC 165 CG3195-PC 1..165 1..165 846 100 Plus
RpL12-PB 165 CG3195-PB 1..165 1..165 846 100 Plus
RpL12-PA 165 CG3195-PA 1..165 1..165 846 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18857-PA 165 GI18857-PA 1..165 1..165 826 94.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11659-PA 165 GL11659-PA 1..165 1..165 836 95.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16582-PA 165 GA16582-PA 1..165 1..165 836 95.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18298-PA 165 GM18298-PA 1..165 1..165 857 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11830-PA 165 GD11830-PA 1..165 1..165 857 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20445-PA 165 GJ20445-PA 1..165 1..165 834 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21921-PA 165 GK21921-PA 1..165 1..165 819 93.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL12-PA 165 GE14368-PA 1..165 1..165 857 100 Plus