BDGP Sequence Production Resources |
Search the DGRC for RE28824
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 288 |
Well: | 24 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL12-RA |
Protein status: | RE28824.pep: gold |
Preliminary Size: | 706 |
Sequenced Size: | 644 |
Gene | Date | Evidence |
---|---|---|
CG3195 | 2001-12-14 | Blastp of sequenced clone |
CG3195 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3204 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL12 | 2008-04-29 | Release 5.5 accounting |
RpL12 | 2008-08-15 | Release 5.9 accounting |
RpL12 | 2008-12-18 | 5.12 accounting |
644 bp (644 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071246
> RE28824.complete AATAATCGATAGCTTCTTCTTTCTTTTTCTGTGTGTCTTTTTTGCGCGAC TGTTCAAGCCAAGATACCGCTATGCCTCCCAAATTCGACCCAACGGAAGT TAAATTGGTGTACCTGCGTTGCGTGGGCGGAGAAGTCGGTGCCACATCCT CCCTGGCCCCAAAGATCGGTCCCCTCGGTCTGTCGCCCAAGAAAATCGGT GATGACATCGCCAAGGCCACCTCCGACTGGAAGGGTCTGAAGATCACCGT CTGCCTGACCATCCAGAACCGACAGGCCGCCATCTCCGTGGTTCCCTCCG CCGCCTCGCTGATCATCAAGGCTCTGAAGGAACCCCCACGTGACCGCAAG AAGCAGAAGAACATCAAGCACAGTGGAAACATTGGCTTCGAAGACATTCT GGCCATCGCCCGCGTGATGAGGCCCAGGTCCATGGCCCGTGAGTTGAAGG GAACCTGCAAGGAAGTTCTGGGAACCGCCCAGAGCGTCGGCTGCACCGTT GACGGAAAGCACCCTCACGATGTTATTGACGAACTGAACGAGGGCTCCAT TGAAGTCCCCGCGGAATAAACAGTTTTTTAAACAGAATTAATAAATTGTA CGCGATACAGTCTGTAATAATTGACCCGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL12-RA | 1177 | RpL12-RA | 107..730 | 4..627 | 3120 | 100 | Plus |
RpL12-RB | 939 | RpL12-RB | 147..728 | 46..627 | 2910 | 100 | Plus |
RpL12.b | 1175 | RpL12.b | 147..728 | 46..627 | 2910 | 100 | Plus |
RpL12-RB | 939 | RpL12-RB | 37..79 | 4..46 | 215 | 100 | Plus |
RpL12.b | 1175 | RpL12.b | 37..79 | 4..46 | 215 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19947173..19947436 | 364..627 | 1320 | 100 | Plus |
chr2R | 21145070 | chr2R | 19946838..19947019 | 182..363 | 910 | 100 | Plus |
chr2R | 21145070 | chr2R | 19946701..19946775 | 108..182 | 360 | 98.7 | Plus |
chr2R | 21145070 | chr2R | 19946538..19946600 | 46..108 | 315 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24061150..24061413 | 364..627 | 1320 | 100 | Plus |
2R | 25286936 | 2R | 24060812..24060993 | 182..363 | 910 | 100 | Plus |
2R | 25286936 | 2R | 24060675..24060749 | 108..182 | 375 | 100 | Plus |
2R | 25286936 | 2R | 24060512..24060574 | 46..108 | 315 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24062349..24062612 | 364..627 | 1320 | 100 | Plus |
2R | 25260384 | 2R | 24062011..24062192 | 182..363 | 910 | 100 | Plus |
2R | 25260384 | 2R | 24061874..24061948 | 108..182 | 375 | 100 | Plus |
2R | 25260384 | 2R | 24061711..24061773 | 46..108 | 315 | 100 | Plus |
2R | 25260384 | 2R | 24061601..24061643 | 4..46 | 215 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19946426..19946470 | 1..46 | 95 | -> | Plus |
chr2R | 19946539..19946600 | 47..108 | 100 | -> | Plus |
chr2R | 19946702..19946775 | 109..182 | 98 | -> | Plus |
chr2R | 19946839..19947019 | 183..363 | 100 | -> | Plus |
chr2R | 19947173..19947436 | 364..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 1..498 | 72..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 1..498 | 72..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RA | 1..498 | 72..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 1..498 | 72..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RA | 1..498 | 72..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 2..626 | 4..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 2..626 | 4..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RA | 23..648 | 1..627 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RC | 2..626 | 4..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL12-RA | 23..648 | 1..627 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24060400..24060444 | 1..46 | 95 | -> | Plus |
2R | 24060513..24060574 | 47..108 | 100 | -> | Plus |
2R | 24060676..24060749 | 109..182 | 100 | -> | Plus |
2R | 24060813..24060993 | 183..363 | 100 | -> | Plus |
2R | 24061150..24061413 | 364..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24060400..24060444 | 1..46 | 95 | -> | Plus |
2R | 24060513..24060574 | 47..108 | 100 | -> | Plus |
2R | 24060676..24060749 | 109..182 | 100 | -> | Plus |
2R | 24060813..24060993 | 183..363 | 100 | -> | Plus |
2R | 24061150..24061413 | 364..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24060400..24060444 | 1..46 | 95 | -> | Plus |
2R | 24060513..24060574 | 47..108 | 100 | -> | Plus |
2R | 24060676..24060749 | 109..182 | 100 | -> | Plus |
2R | 24060813..24060993 | 183..363 | 100 | -> | Plus |
2R | 24061150..24061413 | 364..628 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19948036..19948097 | 47..108 | 100 | -> | Plus |
arm_2R | 19948199..19948272 | 109..182 | 100 | -> | Plus |
arm_2R | 19948336..19948516 | 183..363 | 100 | -> | Plus |
arm_2R | 19948673..19948936 | 364..628 | 99 | Plus | |
arm_2R | 19947923..19947967 | 1..46 | 95 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24062367..24062630 | 364..628 | 99 | Plus | |
2R | 24061617..24061661 | 1..46 | 95 | -> | Plus |
2R | 24061730..24061791 | 47..108 | 100 | -> | Plus |
2R | 24061893..24061966 | 109..182 | 100 | -> | Plus |
2R | 24062030..24062210 | 183..363 | 100 | -> | Plus |
Translation from 0 to 568
> RE28824.hyp KSIASSFFFCVSFLRDCSSQDTAMPPKFDPTEVKLVYLRCVGGEVGATSS LAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSA ASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKG TCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVPAE*
Translation from 71 to 568
> RE28824.pep MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKAT SDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKH SGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHD VIDELNEGSIEVPAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11364-PA | 165 | GF11364-PA | 1..165 | 1..165 | 848 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22931-PA | 165 | GG22931-PA | 1..165 | 1..165 | 857 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21709-PA | 165 | GH21709-PA | 1..165 | 1..165 | 814 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL12-PC | 165 | CG3195-PC | 1..165 | 1..165 | 846 | 100 | Plus |
RpL12-PB | 165 | CG3195-PB | 1..165 | 1..165 | 846 | 100 | Plus |
RpL12-PA | 165 | CG3195-PA | 1..165 | 1..165 | 846 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18857-PA | 165 | GI18857-PA | 1..165 | 1..165 | 826 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11659-PA | 165 | GL11659-PA | 1..165 | 1..165 | 836 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16582-PA | 165 | GA16582-PA | 1..165 | 1..165 | 836 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18298-PA | 165 | GM18298-PA | 1..165 | 1..165 | 857 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11830-PA | 165 | GD11830-PA | 1..165 | 1..165 | 857 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20445-PA | 165 | GJ20445-PA | 1..165 | 1..165 | 834 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21921-PA | 165 | GK21921-PA | 1..165 | 1..165 | 819 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL12-PA | 165 | GE14368-PA | 1..165 | 1..165 | 857 | 100 | Plus |