Clone RE28913 Report

Search the DGRC for RE28913

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:289
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCG10340-RA
Protein status:RE28913.pep: gold
Sequenced Size:934

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10340 2008-04-29 Release 5.5 accounting
CG10340 2008-04-29 Picked prior to 5.5
CG10340 2008-08-15 Release 5.9 accounting
CG10340 2008-12-18 5.12 accounting

Clone Sequence Records

RE28913.complete Sequence

934 bp assembled on 2007-09-24

GenBank Submission: BT031014

> RE28913.complete
ATAATTTTTGATGTGAGGTGAGGAAATGGCATGCGCCAAGAAATTGCTTT
TTCGCGTTTTCCTGAATAACTCTTTGACGGCGAACCGCACAATCACCATG
TCCGCCGCGCGACGTGCCGAGGAGGCCATTGAGAAGCTGAAGGAGGACAA
TCCCTACTACTCCAAGTACGCGAGCAAGATTGCCAAGTTGCAGCAGACGT
CGGCTGAGGAGTTCCTGGATCGCGTGGAGCGTGTGGTGAATCCCATCAAA
GATGGGCAGAGCCAGGCCAGGTCCTACTCCGAGCTTCTGAATCCCAAGCA
AAAACTGCAGGCTGAGCAGGCAGCTGAACTGCCCCACAAGAAGCTCACTG
ATATCATGAAACTGGAACTGATTGAGGACAAGACCGCCGAAGAGGTCTCC
CAGATTTGGCTGGAGTACCATAAGACCAAGGAGGTCCTGGCCGCCACTCT
AAGCACATCTCAGTACGAGAACCTCATGGCGCGCGCCAAGGAGCACCCCG
TCTTTCTGCTGCCACTGCCCCGCAGTGAGGGATTCGAGTTTGTCATGCTC
CAGTTCGCAGCCAACACCGTGCACTTCACTCCGCTTTTGGCGTACCAGGT
GCACCATGAGAACGCTCCGGAGTGTCTCACAGTGGTTCACTATACCGAGG
TCCAAGACAAGGGTGTAGTTCTCATGCGCGGTGAATACGACACTAAGGTA
CTCACAGCCCAGGAGGCTCAGTGTCTGGCCAATGAGTTGCAGATGTTCTA
CCTGAAGCCCGACGAGGGCAAGCTGCGCTTGCTGAACACTTTTACCCGTA
AGCCGGACGAGTTCAAGCACATGGATCTAATTAAGGAAGTTGAGAACATA
CAGCTGGTCTAGGCCCTGCGATTTTAATCAAAATAAATAGAACAAACACG
ACAAGGATATATTAAACACGAAAAAAAAAAAAAA

RE28913.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10340-RA 1026 CG10340-RA 110..1026 1..917 4585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12437951..12438604 920..267 3270 100 Minus
chr3R 27901430 chr3R 12438655..12438926 272..1 1360 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16613395..16614051 923..267 3285 100 Minus
3R 32079331 3R 16614102..16614373 272..1 1360 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16354226..16354882 923..267 3285 100 Minus
3R 31820162 3R 16354933..16355204 272..1 1360 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:17:32 has no hits.

RE28913.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:18:12 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12437951..12438600 271..920 100 <- Minus
chr3R 12438657..12438926 1..270 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:33 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 1..837 26..862 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:06:20 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 1..837 26..862 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:43:28 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 1..837 26..862 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:52:38 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 1..837 26..862 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:58 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 1..837 26..862 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:01:24 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 15..920 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:06:20 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 15..920 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:43:28 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 19..938 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:52:39 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 15..920 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:58 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG10340-RA 19..938 1..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:12 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16613398..16614047 271..920 100 <- Minus
3R 16614104..16614373 1..270 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:12 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16613398..16614047 271..920 100 <- Minus
3R 16614104..16614373 1..270 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:12 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16613398..16614047 271..920 100 <- Minus
3R 16614104..16614373 1..270 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:43:28 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12439120..12439769 271..920 100 <- Minus
arm_3R 12439826..12440095 1..270 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:58:36 Download gff for RE28913.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16354229..16354878 271..920 100 <- Minus
3R 16354935..16355204 1..270 100   Minus

RE28913.hyp Sequence

Translation from 25 to 861

> RE28913.hyp
MACAKKLLFRVFLNNSLTANRTITMSAARRAEEAIEKLKEDNPYYSKYAS
KIAKLQQTSAEEFLDRVERVVNPIKDGQSQARSYSELLNPKQKLQAEQAA
ELPHKKLTDIMKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENL
MARAKEHPVFLLPLPRSEGFEFVMLQFAANTVHFTPLLAYQVHHENAPEC
LTVVHYTEVQDKGVVLMRGEYDTKVLTAQEAQCLANELQMFYLKPDEGKL
RLLNTFTRKPDEFKHMDLIKEVENIQLV*

RE28913.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG10340-PA 278 CG10340-PA 1..278 1..278 1412 100 Plus

RE28913.pep Sequence

Translation from 25 to 861

> RE28913.pep
MACAKKLLFRVFLNNSLTANRTITMSAARRAEEAIEKLKEDNPYYSKYAS
KIAKLQQTSAEEFLDRVERVVNPIKDGQSQARSYSELLNPKQKLQAEQAA
ELPHKKLTDIMKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENL
MARAKEHPVFLLPLPRSEGFEFVMLQFAANTVHFTPLLAYQVHHENAPEC
LTVVHYTEVQDKGVVLMRGEYDTKVLTAQEAQCLANELQMFYLKPDEGKL
RLLNTFTRKPDEFKHMDLIKEVENIQLV*

RE28913.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17929-PA 277 GF17929-PA 1..276 1..277 1293 87.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16819-PA 278 GG16819-PA 1..278 1..278 1446 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20483-PA 276 GH20483-PA 1..275 1..277 1156 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10340-PA 278 CG10340-PA 1..278 1..278 1412 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10384-PA 253 GI10384-PA 1..252 25..277 1141 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27290-PA 277 GL27290-PA 1..276 1..277 1196 80.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27026-PA 278 GA27026-PA 1..277 1..277 1219 82 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15417-PA 254 GM15417-PA 1..254 25..278 1333 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20275-PA 278 GD20275-PA 1..278 1..278 1462 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22845-PA 253 GJ22845-PA 1..253 25..278 1143 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22832-PA 254 GK22832-PA 1..253 25..277 1161 84.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\anon-EST:fe2A5-PA 278 GE26137-PA 1..278 1..278 1428 96 Plus