Clone RE28995 Report

Search the DGRC for RE28995

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:289
Well:95
Vector:pFlc-1
Associated Gene/TranscriptNxt1-RA
Protein status:RE28995.pep: gold
Preliminary Size:805
Sequenced Size:538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12752 2001-12-14 Blastp of sequenced clone
CG12752 2002-01-01 Sim4 clustering to Release 2
CG12752 2003-01-01 Sim4 clustering to Release 3
Nxt1 2008-04-29 Release 5.5 accounting
Nxt1 2008-08-15 Release 5.9 accounting
Nxt1 2008-12-18 5.12 accounting

Clone Sequence Records

RE28995.complete Sequence

538 bp (538 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071250

> RE28995.complete
ACTGTAATTCGAGAATCGCGGGAAACATGGACAGCGATTTGAAAGCCAAG
GTCGAGAGCTGCGCCCGTACGGCGGATACCTTCACACGCCTGTACTACGC
CTCCGTGGACAACCGACGCCAACAAATTGGACGCCTCTATTTGGACAATG
CTACGCTTAGCTGGAATGGAAACGGGGCCATCGGCCGCCAGATGATCGAG
AGCTACTTTCAGGAGCTGCCATCCTCAAACCACCAGTTGAACACCCTGGA
CGCGCAGCCTATTGTGGATCAGGCTGTGTCCAACCAGCTGGCCTACCTCA
TCATGGCCAGCGGCTCCGTCAAGTTCGCAGATCAGCAGTTACGCAAATTT
CAGCAGACTTTCATCGTTACCGCCGAGAATGATAAATGGAAGGTCGTCTC
CGATTGCTACCGAATGCAGGAGGTCTGAGATCCACACACTTGTATTTTAA
GCTAAGCTAAAGTTCTTACGTCGTAACGAGTTTATTAACATATCTAAGCT
CTTATAAATAGATTGACTTCCTAAAAAAAAAAAAAAAA

RE28995.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Nxt1-RA 632 Nxt1-RA 86..608 1..523 2600 99.8 Plus
CG5543-RA 2154 CG5543-RA 2080..2154 523..449 375 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19697425..19697824 522..123 1985 99.8 Minus
chr2R 21145070 chr2R 19697895..19697981 122..36 435 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23811324..23811724 523..123 2005 100 Minus
2R 25286936 2R 23811795..23811881 122..36 435 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23812523..23812923 523..123 2005 100 Minus
2R 25260384 2R 23812994..23813080 122..36 435 100 Minus
2R 25260384 2R 23813137..23813172 36..1 165 97.2 Minus
Blast to na_te.dros performed on 2019-03-15 14:09:40 has no hits.

RE28995.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:10:47 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19697425..19697824 123..522 99 <- Minus
chr2R 19697895..19697981 36..122 100 <- Minus
chr2R 19698039..19698073 1..35 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:07:37 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..402 27..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:11 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..402 27..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:21:12 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..402 27..428 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:46 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..402 27..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:52:25 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..402 27..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:51 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..522 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:11 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..522 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:21:12 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 2..523 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:46 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 1..522 1..522 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:52:25 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
Nxt1-RA 2..523 1..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:10:47 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23811325..23811724 123..522 100 <- Minus
2R 23811795..23811881 36..122 100 <- Minus
2R 23811939..23811973 1..35 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:10:47 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23811325..23811724 123..522 100 <- Minus
2R 23811795..23811881 36..122 100 <- Minus
2R 23811939..23811973 1..35 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:10:47 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23811325..23811724 123..522 100 <- Minus
2R 23811795..23811881 36..122 100 <- Minus
2R 23811939..23811973 1..35 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:21:12 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19698848..19699247 123..522 100 <- Minus
arm_2R 19699318..19699404 36..122 100 <- Minus
arm_2R 19699462..19699496 1..35 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:52 Download gff for RE28995.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23812542..23812941 123..522 100 <- Minus
2R 23813012..23813098 36..122 100 <- Minus
2R 23813156..23813190 1..35 97   Minus

RE28995.hyp Sequence

Translation from 2 to 427

> RE28995.hyp
SNSRIAGNMDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNA
TLSWNGNGAIGRQMIESYFQELPSSNHQLNTLDAQPIVDQAVSNQLAYLI
MASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYRMQEV*

RE28995.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Nxt1-PA 133 CG12752-PA 1..133 9..141 683 100 Plus
Nxt1-PB 48 CG12752-PB 1..32 9..40 163 100 Plus

RE28995.pep Sequence

Translation from 26 to 427

> RE28995.pep
MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNG
AIGRQMIESYFQELPSSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKF
ADQQLRKFQQTFIVTAENDKWKVVSDCYRMQEV*

RE28995.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12459-PA 135 GF12459-PA 1..132 1..132 579 75.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19997-PA 133 GG19997-PA 1..133 1..133 627 85 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13218-PA 134 GH13218-PA 1..132 1..132 511 65.9 Plus
Dgri\GH24133-PA 138 GH24133-PA 3..134 1..132 500 64.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Nxt1-PA 133 CG12752-PA 1..133 1..133 683 100 Plus
Nxt1-PB 48 CG12752-PB 1..32 1..32 163 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16389-PA 135 GI16389-PA 1..132 1..132 532 68.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11070-PA 135 GL11070-PA 1..133 1..133 545 73.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11789-PA 135 GA11789-PA 1..133 1..133 545 73.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15511-PA 133 GM15511-PA 1..133 1..133 680 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25012-PA 133 GD25012-PA 1..133 1..133 680 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17007-PA 135 GJ17007-PA 1..132 1..132 533 68.9 Plus
Dvir\GJ17006-PA 135 GJ17006-PA 1..132 1..132 493 61.4 Plus
Dvir\GJ17005-PA 135 GJ17005-PA 1..132 1..132 369 51.5 Plus
Dvir\GJ17003-PA 133 GJ17003-PA 4..132 1..130 345 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23344-PA 135 GK23344-PA 1..133 1..133 534 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Nxt1-PA 133 GE11531-PA 1..133 1..133 635 86.5 Plus