Clone RE29623 Report

Search the DGRC for RE29623

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:296
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG12400-RA
Protein status:RE29623.pep: gold
Preliminary Size:422
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12400 2002-01-01 Sim4 clustering to Release 2
CG12400 2002-05-18 Blastp of sequenced clone
CG12400 2003-01-01 Sim4 clustering to Release 3
CG12400 2008-04-29 Release 5.5 accounting
CG12400 2008-08-15 Release 5.9 accounting
CG12400 2008-12-18 5.12 accounting

Clone Sequence Records

RE29623.complete Sequence

471 bp (471 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119127

> RE29623.complete
AGTTGCCCACCGCTATTGTTTTTCATCCTATCAACATGAGTGCCGTGAAC
GATCCGCTGGAACTTTTGACGAACAAGGGCACCCACGAGCCTTCTTTCCT
CTCGCCGATATGGAATCCGATTGCCTGCGGTGTGGCCGGCGTGGGCGCGG
CCATTTTCATCAACTGGGGCTTCCGTAAGCCCGTGTTTTCCGGCATCCAG
AAGCACATCGCCTTCGGAGCTATCGGCGTCGGCGCAGGAGCTTATTTCGA
TCAGAAGAGGAACGAGTACCTGGCCAAAAGGGACGCCGTCCTCCGGCACT
ACATCGAACTGCATCCCGACGATTTCCCGGTGAAGGAACGCAAGACCTAT
GGCCAAGTGCTGGAGAGTTGGGTGCCAGTGCGCTAAGTGGATCTAAATCT
TTGTTGTCAAACGAACGATGGAAGTAGTTAATAAAACAGCTTTAATTGTA
AAACATAAAAAAAAAAAAAAA

RE29623.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12400-RA 762 CG12400-RA 130..586 1..457 2285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3145187..3145379 193..1 965 100 Minus
chr2L 23010047 chr2L 3144965..3145109 336..192 725 100 Minus
chr2L 23010047 chr2L 3144790..3144910 456..336 605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3145527..3145719 193..1 965 100 Minus
2L 23513712 2L 3145305..3145449 336..192 725 100 Minus
2L 23513712 2L 3145129..3145250 457..336 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3145527..3145719 193..1 965 100 Minus
2L 23513712 2L 3145305..3145449 336..192 725 100 Minus
2L 23513712 2L 3145129..3145250 457..336 610 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:55:32 has no hits.

RE29623.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:56:10 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3145188..3145379 1..192 100   Minus
chr2L 3144965..3145108 193..336 100 <- Minus
chr2L 3144790..3144909 337..456 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:02 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..351 36..386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:55 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..351 36..386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:45:21 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..351 36..386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:22 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..351 36..386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:54:03 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..351 36..386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:55 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:55 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:45:21 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 3..458 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:22 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:54:03 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
CG12400-RA 3..458 1..456 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:56:10 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3145130..3145249 337..456 100 <- Minus
2L 3145305..3145448 193..336 100 <- Minus
2L 3145528..3145719 1..192 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:56:10 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3145130..3145249 337..456 100 <- Minus
2L 3145305..3145448 193..336 100 <- Minus
2L 3145528..3145719 1..192 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:56:10 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3145130..3145249 337..456 100 <- Minus
2L 3145305..3145448 193..336 100 <- Minus
2L 3145528..3145719 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:45:21 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3145130..3145249 337..456 100 <- Minus
arm_2L 3145305..3145448 193..336 100 <- Minus
arm_2L 3145528..3145719 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:34 Download gff for RE29623.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3145305..3145448 193..336 100 <- Minus
2L 3145130..3145249 337..456 100 <- Minus
2L 3145528..3145719 1..192 100   Minus

RE29623.hyp Sequence

Translation from 2 to 385

> RE29623.hyp
LPTAIVFHPINMSAVNDPLELLTNKGTHEPSFLSPIWNPIACGVAGVGAA
IFINWGFRKPVFSGIQKHIAFGAIGVGAGAYFDQKRNEYLAKRDAVLRHY
IELHPDDFPVKERKTYGQVLESWVPVR*

RE29623.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12400-PB 116 CG12400-PB 1..116 12..127 624 100 Plus
CG12400-PA 116 CG12400-PA 1..116 12..127 624 100 Plus

RE29623.pep Sequence

Translation from 35 to 385

> RE29623.pep
MSAVNDPLELLTNKGTHEPSFLSPIWNPIACGVAGVGAAIFINWGFRKPV
FSGIQKHIAFGAIGVGAGAYFDQKRNEYLAKRDAVLRHYIELHPDDFPVK
ERKTYGQVLESWVPVR*

RE29623.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20581-PA 116 GF20581-PA 1..116 1..116 544 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24458-PA 116 GG24458-PA 1..116 1..116 590 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10285-PA 118 GH10285-PA 4..118 2..116 491 75.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B14.5B-PB 116 CG12400-PB 1..116 1..116 624 100 Plus
ND-B14.5B-PA 116 CG12400-PA 1..116 1..116 624 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17982-PA 118 GI17982-PA 5..118 3..116 416 73.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26532-PA 118 GL26532-PA 3..118 1..116 463 81.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11610-PA 118 GA11610-PA 3..118 1..116 463 81.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18165-PA 116 GM18165-PA 1..116 1..116 609 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22775-PA 116 GD22775-PA 1..116 1..116 605 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19555-PA 118 GJ19555-PA 4..118 2..116 474 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18269-PA 118 GK18269-PA 4..118 2..116 515 82.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14937-PA 116 GE14937-PA 1..116 1..116 584 91.4 Plus