BDGP Sequence Production Resources |
Search the DGRC for RE29678
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 296 |
Well: | 78 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14572-RA |
Protein status: | RE29678.pep: gold |
Preliminary Size: | 774 |
Sequenced Size: | 925 |
Gene | Date | Evidence |
---|---|---|
CG14572 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14572 | 2002-02-22 | Blastp of sequenced clone |
CG14572 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14572 | 2008-04-29 | Release 5.5 accounting |
CG14572 | 2008-08-15 | Release 5.9 accounting |
CG14572 | 2008-12-18 | 5.12 accounting |
925 bp (925 high quality bases) assembled on 2002-02-22
GenBank Submission: AY084148
> RE29678.complete AGTGGGGTCTAAATTCGGGCCGAGATCGAAAGTCCAACATGCAGTCCATT CTACCCGTTATCCTTTGCCTTTGGGCCCTTAGTCCCGTCCAGATCGAAGC GCGTCAGGTCAGGATCAACCGGTATGCGGTCACTGTGCAGGAGGATCAGC CGGCCGAGGATGCTCCCTATCCGGCGGCGGGCTATAGACCACAAGGTCGC TCCTTCTGGCTGCCAAGCGAAGTGGAAGTAGAGGTCATTGAAGGGCCTGG TGCTGTTGAAGCTGAGGTTCAGGAAGGCTCAGGTTTGGGAACGAATCAGC TGACCACCACAACCGAGCTGCCTCTGGAGGATTTGTCGACCAGCACTACA GATCCAACCGACGACTGGAGCACGACCACCAACTGGGGCTCCGTGGACAC GTCCACAGCTCTCCCAGCTACTCTCGCTGTGGAATCCCGTACGGGTCGGG CTTTTGTAAAAGCTCCTTATCCACCAGCCGGCTACAGACCAAGTCGCGCC TTCCGCCTGCCCACCGAGCAGAGCAGGGAGGAGGAGCAGAAAACCTCCTC CAGCAACTCCACCGACAGCAATGCCGATCACCCGGTCTGCGGGGTCAGCA CTGACCCCCTGAAACCCACTCCGGAACCTGGATCCAAGGATGAGCCGGAT TCGGAGAGTGTGGTCTTTACTGCAAATGTGGGACCTGCTGTAGTGGTGGC TAGAGTTCCCTCCTCCATTCCGGTGGCTATTCCCCTGCGATCGCAGCCTC TGATCCAGGCTCCCAGGTCCCGGGGATTTGTCTACACCACGCATGTGGAG CAGCGGTGGTGATGGGACGGAAGGTACTCATTATCATTGTTAACAGTTCA GTATTTAAAGTTACTTTTGTTTATGAAGAAATAAATGCTTTCTTTTGTTA TTTAAAAAAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14572-RA | 904 | CG14572-RA | 1..904 | 1..904 | 4490 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21730474..21731377 | 1..904 | 4490 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21741539..21742442 | 1..904 | 4490 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21734639..21735542 | 1..904 | 4490 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pogo | 2121 | pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). | 1959..2038 | 828..909 | 144 | 70.6 | Plus |
diver | 6112 | diver Tinker 6112bp | 135..164 | 858..887 | 114 | 86.7 | Plus |
diver | 6112 | diver Tinker 6112bp | 6023..6052 | 858..887 | 114 | 86.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21730474..21731377 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..774 | 39..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..774 | 39..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..774 | 39..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..774 | 39..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..774 | 39..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..904 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..903 | 1..903 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 6..908 | 1..903 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 1..904 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14572-RA | 6..908 | 1..903 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21741539..21742442 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21741539..21742442 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21741539..21742442 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21734639..21735542 | 1..904 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21734639..21735542 | 1..904 | 99 | Plus |
Translation from 2 to 811
> RE29678.hyp LGLNSGRDRKSNMQSILPVILCLWALSPVQIEARQVRINRYAVTVQEDQP AEDAPYPAAGYRPQGRSFWLPSEVEVEVIEGPGAVEAEVQEGSGLGTNQL TTTTELPLEDLSTSTTDPTDDWSTTTNWGSVDTSTALPATLAVESRTGRA FVKAPYPPAGYRPSRAFRLPTEQSREEEQKTSSSNSTDSNADHPVCGVST DPLKPTPEPGSKDEPDSESVVFTANVGPAVVVARVPSSIPVAIPLRSQPL IQAPRSRGFVYTTHVEQRW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14572-PA | 257 | CG14572-PA | 1..257 | 13..269 | 1337 | 100 | Plus |
Translation from 38 to 811
> RE29678.pep MQSILPVILCLWALSPVQIEARQVRINRYAVTVQEDQPAEDAPYPAAGYR PQGRSFWLPSEVEVEVIEGPGAVEAEVQEGSGLGTNQLTTTTELPLEDLS TSTTDPTDDWSTTTNWGSVDTSTALPATLAVESRTGRAFVKAPYPPAGYR PSRAFRLPTEQSREEEQKTSSSNSTDSNADHPVCGVSTDPLKPTPEPGSK DEPDSESVVFTANVGPAVVVARVPSSIPVAIPLRSQPLIQAPRSRGFVYT THVEQRW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25167-PA | 241 | GF25167-PA | 1..241 | 1..257 | 848 | 69.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16221-PA | 255 | GG16221-PA | 1..255 | 1..257 | 1077 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16371-PA | 255 | GH16371-PA | 1..255 | 1..257 | 684 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14572-PA | 257 | CG14572-PA | 1..257 | 1..257 | 1337 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11562-PA | 250 | GI11562-PA | 1..250 | 1..257 | 680 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24860-PA | 263 | GL24860-PA | 5..263 | 4..257 | 718 | 64.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13090-PA | 261 | GA13090-PA | 5..261 | 4..257 | 753 | 65.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22403-PA | 259 | GM22403-PA | 1..259 | 1..257 | 1236 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14994-PA | 259 | GD14994-PA | 1..259 | 1..257 | 1220 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11242-PA | 261 | GJ11242-PA | 1..261 | 1..257 | 678 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17061-PA | 253 | GK17061-PA | 19..253 | 20..257 | 597 | 58 | Plus |