Clone RE29678 Report

Search the DGRC for RE29678

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:296
Well:78
Vector:pFlc-1
Associated Gene/TranscriptCG14572-RA
Protein status:RE29678.pep: gold
Preliminary Size:774
Sequenced Size:925

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14572 2002-01-01 Sim4 clustering to Release 2
CG14572 2002-02-22 Blastp of sequenced clone
CG14572 2003-01-01 Sim4 clustering to Release 3
CG14572 2008-04-29 Release 5.5 accounting
CG14572 2008-08-15 Release 5.9 accounting
CG14572 2008-12-18 5.12 accounting

Clone Sequence Records

RE29678.complete Sequence

925 bp (925 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084148

> RE29678.complete
AGTGGGGTCTAAATTCGGGCCGAGATCGAAAGTCCAACATGCAGTCCATT
CTACCCGTTATCCTTTGCCTTTGGGCCCTTAGTCCCGTCCAGATCGAAGC
GCGTCAGGTCAGGATCAACCGGTATGCGGTCACTGTGCAGGAGGATCAGC
CGGCCGAGGATGCTCCCTATCCGGCGGCGGGCTATAGACCACAAGGTCGC
TCCTTCTGGCTGCCAAGCGAAGTGGAAGTAGAGGTCATTGAAGGGCCTGG
TGCTGTTGAAGCTGAGGTTCAGGAAGGCTCAGGTTTGGGAACGAATCAGC
TGACCACCACAACCGAGCTGCCTCTGGAGGATTTGTCGACCAGCACTACA
GATCCAACCGACGACTGGAGCACGACCACCAACTGGGGCTCCGTGGACAC
GTCCACAGCTCTCCCAGCTACTCTCGCTGTGGAATCCCGTACGGGTCGGG
CTTTTGTAAAAGCTCCTTATCCACCAGCCGGCTACAGACCAAGTCGCGCC
TTCCGCCTGCCCACCGAGCAGAGCAGGGAGGAGGAGCAGAAAACCTCCTC
CAGCAACTCCACCGACAGCAATGCCGATCACCCGGTCTGCGGGGTCAGCA
CTGACCCCCTGAAACCCACTCCGGAACCTGGATCCAAGGATGAGCCGGAT
TCGGAGAGTGTGGTCTTTACTGCAAATGTGGGACCTGCTGTAGTGGTGGC
TAGAGTTCCCTCCTCCATTCCGGTGGCTATTCCCCTGCGATCGCAGCCTC
TGATCCAGGCTCCCAGGTCCCGGGGATTTGTCTACACCACGCATGTGGAG
CAGCGGTGGTGATGGGACGGAAGGTACTCATTATCATTGTTAACAGTTCA
GTATTTAAAGTTACTTTTGTTTATGAAGAAATAAATGCTTTCTTTTGTTA
TTTAAAAAAGAAAAAAAAAAAAAAA

RE29678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14572-RA 904 CG14572-RA 1..904 1..904 4490 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21730474..21731377 1..904 4490 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21741539..21742442 1..904 4490 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21734639..21735542 1..904 4490 99.7 Plus
Blast to na_te.dros performed 2019-03-16 13:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
pogo 2121 pogo DMPOGOR11 2121bp AKA(S90749) Derived from X59837 (g8354) (Rel. 45, Last updated, Version 10). 1959..2038 828..909 144 70.6 Plus
diver 6112 diver Tinker 6112bp 135..164 858..887 114 86.7 Plus
diver 6112 diver Tinker 6112bp 6023..6052 858..887 114 86.7 Plus

RE29678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:25 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21730474..21731377 1..904 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:04 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..774 39..812 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:38:35 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..774 39..812 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:47:54 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..774 39..812 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:55 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..774 39..812 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:08:52 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..774 39..812 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:38 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..904 1..904 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:38:35 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..903 1..903 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:47:54 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 6..908 1..903 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:55 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 1..904 1..904 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:08:52 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14572-RA 6..908 1..903 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:25 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21741539..21742442 1..904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:25 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21741539..21742442 1..904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:25 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21741539..21742442 1..904 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:47:54 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21734639..21735542 1..904 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:03 Download gff for RE29678.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21734639..21735542 1..904 99   Plus

RE29678.hyp Sequence

Translation from 2 to 811

> RE29678.hyp
LGLNSGRDRKSNMQSILPVILCLWALSPVQIEARQVRINRYAVTVQEDQP
AEDAPYPAAGYRPQGRSFWLPSEVEVEVIEGPGAVEAEVQEGSGLGTNQL
TTTTELPLEDLSTSTTDPTDDWSTTTNWGSVDTSTALPATLAVESRTGRA
FVKAPYPPAGYRPSRAFRLPTEQSREEEQKTSSSNSTDSNADHPVCGVST
DPLKPTPEPGSKDEPDSESVVFTANVGPAVVVARVPSSIPVAIPLRSQPL
IQAPRSRGFVYTTHVEQRW*

RE29678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14572-PA 257 CG14572-PA 1..257 13..269 1337 100 Plus

RE29678.pep Sequence

Translation from 38 to 811

> RE29678.pep
MQSILPVILCLWALSPVQIEARQVRINRYAVTVQEDQPAEDAPYPAAGYR
PQGRSFWLPSEVEVEVIEGPGAVEAEVQEGSGLGTNQLTTTTELPLEDLS
TSTTDPTDDWSTTTNWGSVDTSTALPATLAVESRTGRAFVKAPYPPAGYR
PSRAFRLPTEQSREEEQKTSSSNSTDSNADHPVCGVSTDPLKPTPEPGSK
DEPDSESVVFTANVGPAVVVARVPSSIPVAIPLRSQPLIQAPRSRGFVYT
THVEQRW*

RE29678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25167-PA 241 GF25167-PA 1..241 1..257 848 69.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16221-PA 255 GG16221-PA 1..255 1..257 1077 83 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16371-PA 255 GH16371-PA 1..255 1..257 684 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14572-PA 257 CG14572-PA 1..257 1..257 1337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11562-PA 250 GI11562-PA 1..250 1..257 680 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24860-PA 263 GL24860-PA 5..263 4..257 718 64.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13090-PA 261 GA13090-PA 5..261 4..257 753 65.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22403-PA 259 GM22403-PA 1..259 1..257 1236 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14994-PA 259 GD14994-PA 1..259 1..257 1220 94.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11242-PA 261 GJ11242-PA 1..261 1..257 678 57.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17061-PA 253 GK17061-PA 19..253 20..257 597 58 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23033-PA 255 GE23033-PA 1..255 1..256 1088 83.7 Plus
Dyak\GE19789-PA 255 GE19789-PA 1..255 1..256 1072 82.2 Plus