BDGP Sequence Production Resources |
Search the DGRC for RE29690
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 296 |
Well: | 90 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CoVIb-RB |
Protein status: | RE29690.pep: gold |
Sequenced Size: | 526 |
Gene | Date | Evidence |
---|---|---|
Lost to the ancients | 2009-01-20 | I'm sure there was a reason |
526 bp assembled on 2009-01-20
GenBank Submission: BT058032.1
> RE29690.complete ATTTTTCGTCGTACTCTCGTAACAACAAAGCGACAAATCGTCAGACAGCA GCAACATGTCCGCCTACAAGCTGGAGACCGCCCCGTTCGACCCACGGTTC CCTAACCAGAACGTGACCCGCTACTGCTACCAGTCGTACATCGACTTCCA CCGCTGCCAGAAGAAGCGCGGCGAGGACTTCGCGCCCTGCAACTACTTCC AGAAGGTCTACAAGTCGATGTGCCCCAACGCCTGGGTGGAGAAGTGGGAC GACCAGCGCGAGAGCGGCACATTCCCCGGCCGCATCTAAGCTGCGCCAGA GACGCAGCAACACAGTAAACCCAGCAATCCAGCACCCAAACACACAGGAC ACGATCGATGGACGGACGGAGGTAGAGGAGCGTGGTAACCAGAATCCGGC AATTGCAACAGAGACTAGTTTGTGTTTGTGCTTTCCCCAGCGGTGAATGC AGACCATCATCGGCAAATACAAAAAAAAAAAATACACAAATGTTCAATTA CTTGAATTCTGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14235-RB | 696 | CG14235-RB | 48..559 | 1..513 | 2525 | 99.8 | Plus |
CG14235-RC | 671 | CG14235-RC | 48..562 | 1..513 | 2470 | 99.2 | Plus |
CG14235-RA | 738 | CG14235-RA | 113..596 | 29..513 | 2385 | 99.7 | Plus |
CG14235-RA | 738 | CG14235-RA | 48..77 | 1..30 | 150 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 19629396..19629878 | 511..29 | 2370 | 99.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 19740684..19741167 | 513..29 | 2375 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 590..706 | 39..159 | 118 | 59 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 19629396..19629876 | 31..511 | 99 | <- | Minus |
chrX | 19632973..19633002 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14235-RA | 22..291 | 21..289 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14235-RA | 22..291 | 21..289 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIb-RA | 22..291 | 21..289 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIb-RA | 22..291 | 21..289 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14235-RB | 48..557 | 1..511 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14235-RB | 48..557 | 1..511 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIb-RB | 48..557 | 1..511 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIb-RB | 45..554 | 1..511 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19740686..19741165 | 31..511 | 99 | <- | Minus |
X | 19744262..19744291 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19740686..19741165 | 31..511 | 99 | <- | Minus |
X | 19744262..19744291 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19740686..19741165 | 31..511 | 99 | <- | Minus |
X | 19744262..19744291 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 19634719..19635198 | 31..511 | 99 | <- | Minus |
arm_X | 19638295..19638324 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19748784..19749263 | 31..511 | 99 | <- | Minus |
X | 19752360..19752389 | 1..30 | 100 | Minus |
Translation from 55 to 288
> RE29690.pep MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK VYKSMCPNAWVEKWDDQRESGTFPGRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20466-PA | 77 | GF20466-PA | 1..77 | 1..77 | 407 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18026-PA | 77 | GG18026-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17817-PA | 77 | GH17817-PA | 1..77 | 1..77 | 409 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
COX6B-PD | 77 | CG14235-PD | 1..77 | 1..77 | 444 | 100 | Plus |
COX6B-PB | 77 | CG14235-PB | 1..77 | 1..77 | 444 | 100 | Plus |
COX6B-PC | 77 | CG14235-PC | 1..77 | 1..77 | 444 | 100 | Plus |
COX6B-PA | 96 | CG14235-PA | 20..96 | 1..77 | 444 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16427-PA | 77 | GI16427-PA | 1..77 | 1..77 | 398 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14818-PA | 77 | GL14818-PA | 1..77 | 1..77 | 415 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12848-PA | 77 | GA12848-PA | 1..77 | 1..77 | 415 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22709-PA | 77 | GM22709-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CoVIb-PA | 77 | GD15565-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15830-PA | 77 | GJ15830-PA | 1..77 | 1..77 | 403 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15866-PA | 77 | GK15866-PA | 1..77 | 1..77 | 409 | 96.1 | Plus |
Dwil\GK15083-PA | 77 | GK15083-PA | 1..77 | 1..77 | 375 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17355-PA | 77 | GE17355-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Translation from 55 to 288
> RE29690.hyp MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK VYKSMCPNAWVEKWDDQRESGTFPGRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CoVIb-PD | 77 | CG14235-PD | 1..77 | 1..77 | 444 | 100 | Plus |
CoVIb-PB | 77 | CG14235-PB | 1..77 | 1..77 | 444 | 100 | Plus |
CoVIb-PC | 77 | CG14235-PC | 1..77 | 1..77 | 444 | 100 | Plus |
CoVIb-PA | 96 | CG14235-PA | 20..96 | 1..77 | 444 | 100 | Plus |