Clone RE29690 Report

Search the DGRC for RE29690

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:296
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCoVIb-RB
Protein status:RE29690.pep: gold
Sequenced Size:526

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2009-01-20 I'm sure there was a reason

Clone Sequence Records

RE29690.complete Sequence

526 bp assembled on 2009-01-20

GenBank Submission: BT058032.1

> RE29690.complete
ATTTTTCGTCGTACTCTCGTAACAACAAAGCGACAAATCGTCAGACAGCA
GCAACATGTCCGCCTACAAGCTGGAGACCGCCCCGTTCGACCCACGGTTC
CCTAACCAGAACGTGACCCGCTACTGCTACCAGTCGTACATCGACTTCCA
CCGCTGCCAGAAGAAGCGCGGCGAGGACTTCGCGCCCTGCAACTACTTCC
AGAAGGTCTACAAGTCGATGTGCCCCAACGCCTGGGTGGAGAAGTGGGAC
GACCAGCGCGAGAGCGGCACATTCCCCGGCCGCATCTAAGCTGCGCCAGA
GACGCAGCAACACAGTAAACCCAGCAATCCAGCACCCAAACACACAGGAC
ACGATCGATGGACGGACGGAGGTAGAGGAGCGTGGTAACCAGAATCCGGC
AATTGCAACAGAGACTAGTTTGTGTTTGTGCTTTCCCCAGCGGTGAATGC
AGACCATCATCGGCAAATACAAAAAAAAAAAATACACAAATGTTCAATTA
CTTGAATTCTGAAAAAAAAAAAAAAA

RE29690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14235-RB 696 CG14235-RB 48..559 1..513 2525 99.8 Plus
CG14235-RC 671 CG14235-RC 48..562 1..513 2470 99.2 Plus
CG14235-RA 738 CG14235-RA 113..596 29..513 2385 99.7 Plus
CG14235-RA 738 CG14235-RA 48..77 1..30 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19629396..19629878 511..29 2370 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19740684..19741167 513..29 2375 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19748782..19749265 513..29 2385 99.7 Minus
X 23527363 X 19752360..19752389 30..1 150 100 Minus
Blast to na_te.dros performed 2019-03-15 15:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 590..706 39..159 118 59 Plus

RE29690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:04:52 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19629396..19629876 31..511 99 <- Minus
chrX 19632973..19633002 1..30 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:38 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CG14235-RA 22..291 21..289 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:45 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CG14235-RA 22..291 21..289 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:00:51 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIb-RA 22..291 21..289 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:15 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIb-RA 22..291 21..289 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-20 11:18:15 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CG14235-RB 48..557 1..511 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:45 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CG14235-RB 48..557 1..511 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:00:51 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIb-RB 48..557 1..511 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:15 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIb-RB 45..554 1..511 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:52 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
X 19740686..19741165 31..511 99 <- Minus
X 19744262..19744291 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:52 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
X 19740686..19741165 31..511 99 <- Minus
X 19744262..19744291 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:04:52 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
X 19740686..19741165 31..511 99 <- Minus
X 19744262..19744291 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:00:51 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19634719..19635198 31..511 99 <- Minus
arm_X 19638295..19638324 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:33 Download gff for RE29690.complete
Subject Subject Range Query Range Percent Splice Strand
X 19748784..19749263 31..511 99 <- Minus
X 19752360..19752389 1..30 100   Minus

RE29690.pep Sequence

Translation from 55 to 288

> RE29690.pep
MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK
VYKSMCPNAWVEKWDDQRESGTFPGRI*

RE29690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20466-PA 77 GF20466-PA 1..77 1..77 407 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18026-PA 77 GG18026-PA 1..77 1..77 418 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17817-PA 77 GH17817-PA 1..77 1..77 409 96.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
COX6B-PD 77 CG14235-PD 1..77 1..77 444 100 Plus
COX6B-PB 77 CG14235-PB 1..77 1..77 444 100 Plus
COX6B-PC 77 CG14235-PC 1..77 1..77 444 100 Plus
COX6B-PA 96 CG14235-PA 20..96 1..77 444 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16427-PA 77 GI16427-PA 1..77 1..77 398 92.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14818-PA 77 GL14818-PA 1..77 1..77 415 98.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12848-PA 77 GA12848-PA 1..77 1..77 415 98.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22709-PA 77 GM22709-PA 1..77 1..77 418 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVIb-PA 77 GD15565-PA 1..77 1..77 418 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15830-PA 77 GJ15830-PA 1..77 1..77 403 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15866-PA 77 GK15866-PA 1..77 1..77 409 96.1 Plus
Dwil\GK15083-PA 77 GK15083-PA 1..77 1..77 375 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17355-PA 77 GE17355-PA 1..77 1..77 418 100 Plus

RE29690.hyp Sequence

Translation from 55 to 288

> RE29690.hyp
MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK
VYKSMCPNAWVEKWDDQRESGTFPGRI*

RE29690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIb-PD 77 CG14235-PD 1..77 1..77 444 100 Plus
CoVIb-PB 77 CG14235-PB 1..77 1..77 444 100 Plus
CoVIb-PC 77 CG14235-PC 1..77 1..77 444 100 Plus
CoVIb-PA 96 CG14235-PA 20..96 1..77 444 100 Plus