Clone RE29729 Report

Search the DGRC for RE29729

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:297
Well:29
Vector:pFlc-1
Associated Gene/TranscriptTfIIB-RA
Protein status:RE29729.pep: gold
Preliminary Size:1702
Sequenced Size:1425

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5193 2002-01-01 Sim4 clustering to Release 2
CG5193 2003-01-01 Sim4 clustering to Release 3
CG5193 2004-01-20 Blastp of sequenced clone
TfIIB 2008-04-29 Release 5.5 accounting
TfIIB 2008-08-15 Release 5.9 accounting
TfIIB 2008-12-18 5.12 accounting

Clone Sequence Records

RE29729.complete Sequence

1425 bp (1425 high quality bases) assembled on 2005-11-03

GenBank Submission: BT011459

> RE29729.complete
AAAAGTCACATCACCAGTTGATGTGAGTATTAAAAAAATATATAGCTTAC
AGAGTACAAATGGCATCGACATCGAGACTGGACAACAACAAGGTGTGCTG
CTACGCACACCCCGAATCTCCGCTCATCGAGGACTACAGGGCTGGCGATA
TGATTTGCTCCGAGTGTGGTCTGGTGGTTGGGGACCGCGTAATTGATGTG
GGCTCCGAGTGGCGTACCTTTAGCAACGAGAAGAGCGGCGTGGATCCCAG
TCGTGTCGGTGGACCGGAGAATCCGCTGCTCAGTGGCGGCGACTTGTCCA
CCATAATTGGTCCGGGCACAGGATCCGCATCCTTTGACGCCTTTGGAGCA
CCCAAGTACCAAAACAGACGCACCATGAGCAGCTCGGATCGCTCCCTCAT
ATCAGCCTTTAAGGAGATATCCTCGATGGCCGATCGCATTAACTTGCCCA
AAACCATTGTCGATCGGGCCAACAACTTGTTCAAACAGGTTCATGATGGA
AAGAACCTCAAGGGTCGTTCCAACGATGCCAAGGCATCCGCTTGTCTGTA
TATAGCTTGTCGCCAAGAAGGAGTTCCTCGCACATTCAAGGAAATATGTG
CTGTCAGCAAGATCAGCAAAAAAGAGATTGGCCGTTGCTTTAAGCTAACA
TTGAAGGCTCTCGAGACAAGTGTGGATCTCATAACCACTGCGGACTTCAT
GTGCCGCTTCTGCGCCAACTTGGACCTGCCGAACATGGTCCAACGCGCTG
CCACGCACATTGCAAAGAAAGCCGTCGAGATGGATATTGTACCGGGACGT
TCGCCAATTTCTGTGGCCGCAGCCGCAATCTATATGGCCTCACAAGCATC
CGAGCATAAGAGAAGCCAGAAGGAAATCGGTGATATAGCCGGTGTGGCCG
ACGTCACCATCAGACAGTCCTACAAACTTATGTATCCGCACGCAGCTAAG
CTTTTCCCCGAGGACTTTAAGTTTACCACTCCCATTGATCAGTTACCACA
GATGTAATTCTTTTCGTAGATCCGATGCTCAATACTAACGCTAACGTTAA
GTGAAGGAAAATTCCTAATTTAATCACAAATTACGATTTTATTAAATAAA
GTTAGCATAACTAATATTCAAATAGAACTGTTGGACCAATCAGAACATAA
TTAAATCATTGTTAAATTAATTATCTGAGTTAAACCCTTTCAGTTTTTGA
ACTTTATTCCAATGATTCGTAATACTTTGCTTGCTTGATTTATTTTTACA
TTTTTTGTGTATCTTTGGTATAATATAAGCTAATAACCAGAAACAAAAAT
TGCACACTACGTTTATTTGCCAGTTATTTGCGAAAATAAGTTTAACAAAC
CACGTACTCTGTTTATACATAAGCTTTAAGTAATTAGTAATAATATAAAT
GGATAAAAGAAAAAAAAAAAAAAAA

RE29729.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIB-RA 1678 TfIIB-RA 81..1487 2..1408 7035 100 Plus
TfIIB.a 1474 TfIIB.a 70..1401 77..1408 6660 100 Plus
CG5337-RA 2929 CG5337-RA 2680..2929 1408..1159 1250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10431075..10431760 723..1408 3400 99.7 Plus
chr2L 23010047 chr2L 10430309..10430724 75..490 2080 100 Plus
chr2L 23010047 chr2L 10430776..10431012 487..723 1140 98.7 Plus
chr2L 23010047 chr2L 10430179..10430253 2..76 375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10432241..10432926 723..1408 3430 100 Plus
2L 23513712 2L 10431475..10431890 75..490 2080 100 Plus
2L 23513712 2L 10431942..10432178 487..723 1185 100 Plus
2L 23513712 2L 10431345..10431419 2..76 375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10432241..10432926 723..1408 3430 100 Plus
2L 23513712 2L 10431475..10431890 75..490 2080 100 Plus
2L 23513712 2L 10431942..10432178 487..723 1185 100 Plus
2L 23513712 2L 10431345..10431419 2..76 375 100 Plus
Blast to na_te.dros performed 2019-03-16 21:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6827..6960 1273..1409 118 56.9 Plus

RE29729.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:08:54 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10430778..10431012 489..723 98 -> Plus
chr2L 10430178..10430253 1..76 98 -> Plus
chr2L 10430311..10430722 77..488 100 -> Plus
chr2L 10431076..10431760 724..1409 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:07 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 1..948 60..1007 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:46:38 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 1..948 60..1007 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:15 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 1..948 60..1007 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:28:17 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 1..948 60..1007 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:51 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 1..948 60..1007 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:58 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 2..1408 2..1409 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:46:38 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 2..1408 2..1409 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:15 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RB 7..1414 1..1409 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:28:18 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RA 2..1408 2..1409 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:51 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIB-RB 7..1414 1..1409 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:08:54 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10431344..10431419 1..76 98 -> Plus
2L 10431477..10431888 77..488 100 -> Plus
2L 10431944..10432178 489..723 100 -> Plus
2L 10432242..10432926 724..1409 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:08:54 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10431344..10431419 1..76 98 -> Plus
2L 10431477..10431888 77..488 100 -> Plus
2L 10431944..10432178 489..723 100 -> Plus
2L 10432242..10432926 724..1409 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:08:54 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10431344..10431419 1..76 98 -> Plus
2L 10431477..10431888 77..488 100 -> Plus
2L 10431944..10432178 489..723 100 -> Plus
2L 10432242..10432926 724..1409 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:15 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10431944..10432178 489..723 100 -> Plus
arm_2L 10431344..10431419 1..76 98 -> Plus
arm_2L 10431477..10431888 77..488 100 -> Plus
arm_2L 10432242..10432926 724..1409 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:58 Download gff for RE29729.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10431477..10431888 77..488 100 -> Plus
2L 10431944..10432178 489..723 100 -> Plus
2L 10432242..10432926 724..1409 99   Plus
2L 10431344..10431419 1..76 98 -> Plus

RE29729.pep Sequence

Translation from 59 to 1006

> RE29729.pep
MASTSRLDNNKVCCYAHPESPLIEDYRAGDMICSECGLVVGDRVIDVGSE
WRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKY
QNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNL
KGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKA
LETSVDLITTADFMCRFCANLDLPNMVQRAATHIAKKAVEMDIVPGRSPI
SVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFP
EDFKFTTPIDQLPQM*

RE29729.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15790-PA 315 GF15790-PA 1..315 1..315 1688 100 Plus
Dana\GF16885-PA 665 GF16885-PA 17..263 24..286 156 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10133-PA 315 GG10133-PA 1..315 1..315 1688 100 Plus
Dere\GG16780-PA 668 GG16780-PA 17..263 24..286 159 23.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13607-PA 315 GH13607-PA 1..315 1..315 1675 99 Plus
Dgri\GH17498-PA 667 GH17498-PA 17..263 24..286 158 23.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIB-PB 315 CG5193-PB 1..315 1..315 1626 100 Plus
TfIIB-PA 315 CG5193-PA 1..315 1..315 1626 100 Plus
Brf-PB 662 CG31256-PB 17..263 24..286 189 23.3 Plus
Brf-PA 662 CG31256-PA 17..263 24..286 189 23.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20422-PA 315 GI20422-PA 1..315 1..315 1684 99.7 Plus
Dmoj\GI22827-PA 671 GI22827-PA 17..256 24..282 165 25.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19146-PA 315 GL19146-PA 1..315 1..315 1688 100 Plus
Dper\GL23944-PA 665 GL23944-PA 17..263 24..286 165 23.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27746-PB 315 GA27746-PB 1..315 1..315 1688 100 Plus
Dpse\GA16127-PA 665 GA16127-PA 17..263 24..286 165 23.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18405-PA 315 GM18405-PA 1..315 1..315 1677 99.4 Plus
Dsec\GM15370-PA 356 GM15370-PA 17..263 24..286 164 22.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23702-PA 315 GD23702-PA 1..315 1..315 1688 100 Plus
Dsim\GD20238-PA 662 GD20238-PA 17..263 24..286 155 22.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TfIIB-PA 315 GJ13764-PA 1..315 1..315 1684 99.7 Plus
Dvir\GJ22828-PA 666 GJ22828-PA 17..263 24..286 159 23.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14874-PA 315 GK14874-PA 1..315 1..315 1688 100 Plus
Dwil\GK11456-PA 691 GK11456-PA 17..263 24..286 156 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18945-PA 315 GE18945-PA 1..315 1..315 1683 99.7 Plus
Dyak\GE24172-PA 666 GE24172-PA 17..263 24..286 158 23.3 Plus

RE29729.hyp Sequence

Translation from 59 to 1006

> RE29729.hyp
MASTSRLDNNKVCCYAHPESPLIEDYRAGDMICSECGLVVGDRVIDVGSE
WRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKY
QNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNL
KGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKA
LETSVDLITTADFMCRFCANLDLPNMVQRAATHIAKKAVEMDIVPGRSPI
SVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFP
EDFKFTTPIDQLPQM*

RE29729.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIB-PB 315 CG5193-PB 1..315 1..315 1626 100 Plus
TfIIB-PA 315 CG5193-PA 1..315 1..315 1626 100 Plus
Brf-PB 662 CG31256-PB 17..263 24..286 189 23.3 Plus
Brf-PA 662 CG31256-PA 17..263 24..286 189 23.3 Plus