Clone RE29808 Report

Search the DGRC for RE29808

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:298
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCG13311-RA
Protein status:RE29808.pep: gold
Preliminary Size:408
Sequenced Size:582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13311 2001-12-17 Blastp of sequenced clone
CG13311 2002-01-01 Sim4 clustering to Release 2
CG13311 2003-01-01 Sim4 clustering to Release 3
CG13311 2008-04-29 Release 5.5 accounting
CG13311 2008-08-15 Release 5.9 accounting
CG13311 2008-12-18 5.12 accounting

Clone Sequence Records

RE29808.complete Sequence

582 bp (582 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071259

> RE29808.complete
AGTTAGTCCGTTAGTCACATTCAAAGTCAGCATAATGCAGCAATCCCAAA
TCCTAAGAAACCTATGCCTCATTGTGGTTGTAAGCTCGATGGCAGTTCTG
GTCCAAGGAGTGTGCAACAGTTGCCAAGCCAACAATGTGAAATGCCTGAA
TGAAACGCACTATAGCTTTTGCTCCGATAATGTGGCGCCCAATCAGGTCC
TTCAGTGTCCGGATAACAAGGTCTGCACCGACCTGGCAATCATCTGCATG
GACAGCAGTGTAGTGGATAGCTCCTGCTCAGGCACTGCCGATGGATCCTG
CCCCACCTGCGATGGAAACAGCATGTTCGTCTGCACCAGTCGCACCACCT
TCCAGATGTGCGATGGCACCAACCTAACTGGCCAGGTCACCAAGTGCAAG
GACAACAAGATCTGCTCGATTAAATCGGGCAAATACTGCGTGGATCTCTG
CGAAGTGGGTGATTCCGTCGAATGCGATAGGGACAGTCCGCTATAGAACT
TTTGAATTAATTTAAAATGCTTTCACTACCTCATGTCTAAACTATTAAAT
AAACCACGATTTTTGTAAAAAAAAAAAAAAAA

RE29808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13311-RA 635 CG13311-RA 60..627 1..568 2840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8793481..8793982 566..65 2465 99.4 Minus
chr3L 24539361 chr3L 8794040..8794103 64..1 320 100 Minus
chr3L 24539361 chr3L 8795667..8795768 427..326 195 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8801538..8802041 568..65 2520 100 Minus
3L 28110227 3L 8802099..8802162 64..1 320 100 Minus
3L 28110227 3L 8803724..8803825 427..326 180 78.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8794638..8795141 568..65 2520 100 Minus
3L 28103327 3L 8795199..8795262 64..1 320 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:01:50 has no hits.

RE29808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:30 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8793481..8793982 65..566 99 <- Minus
chr3L 8794040..8794103 1..64 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:09 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..462 35..496 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:27:45 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..462 35..496 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:21 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..462 35..496 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:13 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..462 35..496 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:31 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..462 35..496 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:03 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..566 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:27:45 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..566 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:21 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 3..568 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:13 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 1..566 1..566 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:31 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13311-RA 3..568 1..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:30 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8801540..8802041 65..566 100 <- Minus
3L 8802099..8802162 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:30 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8801540..8802041 65..566 100 <- Minus
3L 8802099..8802162 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:30 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8801540..8802041 65..566 100 <- Minus
3L 8802099..8802162 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:21 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8794640..8795141 65..566 100 <- Minus
arm_3L 8795199..8795262 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:35:48 Download gff for RE29808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8794640..8795141 65..566 100 <- Minus
3L 8795199..8795262 1..64 100   Minus

RE29808.hyp Sequence

Translation from 0 to 495

> RE29808.hyp
VSPLVTFKVSIMQQSQILRNLCLIVVVSSMAVLVQGVCNSCQANNVKCLN
ETHYSFCSDNVAPNQVLQCPDNKVCTDLAIICMDSSVVDSSCSGTADGSC
PTCDGNSMFVCTSRTTFQMCDGTNLTGQVTKCKDNKICSIKSGKYCVDLC
EVGDSVECDRDSPL*

RE29808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13311-PA 153 CG13311-PA 1..153 12..164 831 100 Plus
CG32023-PA 160 CG32023-PA 1..158 12..164 491 59.5 Plus
CG14958-PA 145 CG14958-PA 5..142 21..158 231 37.5 Plus
CG34426-PA 296 CG34426-PA 2..144 23..160 214 32.2 Plus
CG13309-PA 229 CG13309-PA 2..143 21..159 203 32.2 Plus

RE29808.pep Sequence

Translation from 34 to 495

> RE29808.pep
MQQSQILRNLCLIVVVSSMAVLVQGVCNSCQANNVKCLNETHYSFCSDNV
APNQVLQCPDNKVCTDLAIICMDSSVVDSSCSGTADGSCPTCDGNSMFVC
TSRTTFQMCDGTNLTGQVTKCKDNKICSIKSGKYCVDLCEVGDSVECDRD
SPL*

RE29808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10145-PA 151 GF10145-PA 1..151 1..151 487 60.9 Plus
Dana\GF20111-PA 145 GF20111-PA 1..144 11..152 374 51 Plus
Dana\GF10121-PA 147 GF10121-PA 9..147 12..150 187 35.9 Plus
Dana\GF24356-PA 320 GF24356-PA 3..147 12..148 164 34.2 Plus
Dana\GF24357-PA 272 GF24357-PA 2..157 4..153 151 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15057-PA 154 GG15057-PA 1..154 1..153 703 89 Plus
Dere\GG15056-PA 158 GG15056-PA 1..156 1..153 451 57.7 Plus
Dere\GG15111-PA 148 GG15111-PA 19..135 21..136 182 39.3 Plus
Dere\GG14349-PA 505 GG14349-PA 6..148 12..149 166 34.2 Plus
Dere\GG14350-PA 209 GG14350-PA 2..129 3..136 138 31.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16137-PA 150 GH16137-PA 2..143 12..150 268 44.4 Plus
Dgri\GH10924-PA 155 GH10924-PA 2..148 4..150 179 34 Plus
Dgri\GH15330-PA 234 GH15330-PA 19..137 24..148 140 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13311-PA 153 CG13311-PA 1..153 1..153 831 100 Plus
CG32023-PA 160 CG32023-PA 1..158 1..153 491 59.5 Plus
CG14958-PA 145 CG14958-PA 5..142 10..147 231 37.5 Plus
CG34426-PA 296 CG34426-PA 2..144 12..149 214 32.2 Plus
CG13309-PA 229 CG13309-PA 2..143 10..148 203 32.2 Plus
CG34427-PB 269 CG34427-PB 8..157 6..153 195 32.9 Plus
CG32024-PA 209 CG32024-PA 9..141 13..149 176 30.7 Plus
CG13308-PB 233 CG13308-PB 1..130 6..135 175 30.1 Plus
CG33258-PC 252 CG33258-PC 6..140 10..139 159 27.2 Plus
CG33258-PB 252 CG33258-PB 6..140 10..139 159 27.2 Plus
CG13075-PB 339 CG13075-PB 3..134 8..129 147 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12406-PA 156 GI12406-PA 1..155 1..153 245 38 Plus
Dmoj\GI13368-PA 149 GI13368-PA 5..136 10..136 184 37.3 Plus
Dmoj\GI12931-PA 304 GI12931-PA 48..172 27..148 140 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24894-PA 143 GL24894-PA 7..140 19..152 182 36.4 Plus
Dper\GL10343-PA 228 GL10343-PA 11..141 13..136 139 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12192-PA 156 GA12192-PA 1..156 1..152 433 53.8 Plus
Dpse\GA13383-PA 150 GA13383-PA 17..147 22..152 181 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24914-PA 153 GM24914-PA 1..153 1..153 765 97.4 Plus
Dsec\GM24913-PA 168 GM24913-PA 1..158 1..153 481 60.8 Plus
Dsec\GM14547-PA 145 GM14547-PA 1..132 6..136 200 38 Plus
Dsec\GM25093-PA 300 GM25093-PA 1..148 7..149 168 31.1 Plus
Dsec\GM25094-PA 245 GM25094-PA 9..133 27..148 157 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12961-PA 153 GD12961-PA 1..153 1..153 765 97.4 Plus
Dsim\GD12960-PA 160 GD12960-PA 1..158 1..153 475 60.8 Plus
Dsim\GD13738-PA 145 GD13738-PA 1..132 6..136 193 38 Plus
Dsim\GD14128-PA 473 GD14128-PA 1..148 7..149 166 31.8 Plus
Dsim\GD14131-PA 229 GD14131-PA 4..124 12..135 151 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12296-PA 158 GJ12296-PA 27..158 26..152 244 42.9 Plus
Dvir\GJ12008-PA 149 GJ12008-PA 2..149 4..150 192 37.1 Plus
Dvir\GJ13074-PA 420 GJ13074-PA 22..150 22..149 144 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17468-PA 151 GK17468-PA 1..151 1..152 368 50 Plus
Dwil\GK13204-PA 148 GK13204-PA 4..148 12..150 187 41.1 Plus
Dwil\GK16739-PA 488 GK16739-PA 29..160 23..149 149 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21281-PA 154 GE21281-PA 1..154 1..153 668 90.3 Plus
Dyak\GE21280-PA 160 GE21280-PA 1..158 1..153 464 58.2 Plus
Dyak\GE21338-PA 148 GE21338-PA 20..135 22..136 178 38.8 Plus
Dyak\GE20779-PA 308 GE20779-PA 1..148 7..149 167 29.1 Plus
Dyak\GE20782-PA 266 GE20782-PA 8..157 6..153 155 33.8 Plus