Clone RE29832 Report

Search the DGRC for RE29832

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:298
Well:32
Vector:pFlc-1
Associated Gene/TranscriptPnn-RA
Protein status:RE29832.pep: gold
Preliminary Size:912
Sequenced Size:1195

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8383 2001-12-14 Blastp of sequenced clone
CG8383 2002-01-01 Sim4 clustering to Release 2
CG8383 2003-01-01 Sim4 clustering to Release 3
Pnn 2008-04-29 Release 5.5 accounting
Pnn 2008-08-15 Release 5.9 accounting
Pnn 2008-12-18 5.12 accounting

Clone Sequence Records

RE29832.complete Sequence

1195 bp (1195 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071261

> RE29832.complete
ATTGATTTTTTACTTTTATGAGCATCTAATTGTACCGACTTAAGTAAAAT
AATTAATTAAACAAAACCTAACTGAAACGTGGGAACAATGGTGAATGACT
CTGGTCTATCGACAGTGGACGACTTGGAGCAAAAACTGAATTCGGCCAAG
CAGTCGCTGGTGATCCTAAATGAAAACATTCGCCGCATTGCTGGTCGCGT
CCCCAAGGAATCCCTGCAGAGATCGGAAAAATTCAAATACACCCAAGATG
GCAAGAAGAACGAGCACAATGGGGACCGACCGTTCCCCCGAAATGCAACA
CCCGGTGGGGTCTTCAAAGACAAGCGGCGAATGTACGAAAGCAAGAATCC
AATTTCCCGTTTCCCAATCGAAGAAAACGAGGGTCGTCCGCCACGGATTA
ACTCGCGGGTCATCCGGGAGATGCCAACTAAAAAGGAGATTGTCGAGGCA
CAGGGCACAGACTCTGAGTCGAGGGCCAGGAATCGCAGGATGTTCGGATC
GCTGTTGGGAACCCTACAGAAGTTCTGTCAGGAGGAATCGCGACTGAAGA
GCAAGGAGGATAAAAAGGCTGAGATCGATAGGAAGGTGGAAAAGCAGGAA
CTGCAGGAAAGAGCGATGCTGAGGAAACAGCGTGAAACACTATTCTTAGA
TAGGAAAAAAAAGCAATTCGAGATCCGTAGATTAGAGTACAAAATGGCCA
GAATGAAGGACTTCAAGGTCTGGGAAGCAACTATGTTGAATGCGAAAAAT
AACATCCGAACAAAAACGAAACCACATCTGTTCTTTAGGCCAAAAGTGCA
TTCGCCTAGAACGGAAAAATTGTTGAGCAAAAGCAAAAGTGAAGCTGATG
TGTTTATAGAATTCCGGCGCGAAGAATTGGAAGTTGAGCTTAAAAACTTG
GAGAACATGAACTTTGGGAAGATGGAAGACGATACTGCAATAGACGAAAG
TTTCTATGAAGAGCCTGACGACGAAGAGCAGTTGGATAAGTGTAAGTAAA
CTTCAGTTTGCACTAGGGCTTGAAATATGATCGTGCGGATATCGCTGTGT
AGGGCAATTGGGTTTCAATTTATAAAACTTATTTATGAAACTTTAATTTA
TAATACAAAAACCAGATCTTAAGCAAATAAATTACAATGCGGTGATTACA
TTTAAAAGTTATATCGTATTTATCAACTCAAAAAAAAAAAAAAAA

RE29832.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Pnn-RA 1419 Pnn-RA 65..1246 1..1182 5895 99.9 Plus
Pnn.a 1381 Pnn.a 27..1208 1..1182 5895 99.9 Plus
Pnn.b 1679 Pnn.b 44..1034 1..991 4940 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5567034..5567993 220..1179 4800 100 Plus
chr3R 27901430 chr3R 5566755..5566975 1..221 1090 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:47:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9741197..9742159 220..1182 4815 100 Plus
3R 32079331 3R 9740922..9741142 1..221 1090 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9482028..9482990 220..1182 4815 100 Plus
3R 31820162 3R 9481753..9481973 1..221 1090 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 01:52:33 has no hits.

RE29832.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:53:20 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5566755..5566975 1..221 99 -> Plus
chr3R 5567036..5567993 222..1179 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:11 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..912 88..999 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:13 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..912 88..999 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:34 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..912 88..999 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:28 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..912 88..999 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:44:07 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..912 88..999 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:24 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..1179 1..1179 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:13 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..1179 1..1179 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:34 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 24..1202 1..1179 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:29 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 1..1179 1..1179 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:44:07 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
Pnn-RA 24..1202 1..1179 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:20 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9740922..9741142 1..221 99 -> Plus
3R 9741199..9742156 222..1179 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:20 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9740922..9741142 1..221 99 -> Plus
3R 9741199..9742156 222..1179 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:20 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9740922..9741142 1..221 99 -> Plus
3R 9741199..9742156 222..1179 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:34 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5566644..5566864 1..221 99 -> Plus
arm_3R 5566921..5567878 222..1179 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:44 Download gff for RE29832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9481753..9481973 1..221 99 -> Plus
3R 9482030..9482987 222..1179 100   Plus

RE29832.hyp Sequence

Translation from 87 to 998

> RE29832.hyp
MVNDSGLSTVDDLEQKLNSAKQSLVILNENIRRIAGRVPKESLQRSEKFK
YTQDGKKNEHNGDRPFPRNATPGGVFKDKRRMYESKNPISRFPIEENEGR
PPRINSRVIREMPTKKEIVEAQGTDSESRARNRRMFGSLLGTLQKFCQEE
SRLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLE
YKMARMKDFKVWEATMLNAKNNIRTKTKPHLFFRPKVHSPRTEKLLSKSK
SEADVFIEFRREELEVELKNLENMNFGKMEDDTAIDESFYEEPDDEEQLD
KCK*

RE29832.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Pnn-PA 303 CG8383-PA 1..303 1..303 1554 100 Plus
Pnn-PB 307 CG8383-PB 1..301 1..301 1540 100 Plus

RE29832.pep Sequence

Translation from 87 to 998

> RE29832.pep
MVNDSGLSTVDDLEQKLNSAKQSLVILNENIRRIAGRVPKESLQRSEKFK
YTQDGKKNEHNGDRPFPRNATPGGVFKDKRRMYESKNPISRFPIEENEGR
PPRINSRVIREMPTKKEIVEAQGTDSESRARNRRMFGSLLGTLQKFCQEE
SRLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLE
YKMARMKDFKVWEATMLNAKNNIRTKTKPHLFFRPKVHSPRTEKLLSKSK
SEADVFIEFRREELEVELKNLENMNFGKMEDDTAIDESFYEEPDDEEQLD
KCK*

RE29832.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11692-PA 311 GF11692-PA 1..299 1..299 1150 73.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17059-PA 302 GG17059-PA 1..302 1..303 1519 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19578-PA 331 GH19578-PA 1..281 1..288 781 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pnn-PA 303 CG8383-PA 1..303 1..303 1554 100 Plus
Pnn-PB 307 CG8383-PB 1..301 1..301 1540 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23628-PA 301 GI23628-PA 1..301 1..303 784 53.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21956-PA 289 GL21956-PA 1..283 1..296 967 64.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21034-PA 289 GA21034-PA 1..283 1..296 969 64.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23830-PA 303 GM23830-PA 1..303 1..303 1534 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11168-PA 300 GJ11168-PA 8..278 8..286 751 56.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13914-PA 304 GK13914-PA 8..286 6..288 792 56.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25978-PA 302 GE25978-PA 1..302 1..303 1518 96 Plus