Clone RE29957 Report

Search the DGRC for RE29957

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:299
Well:57
Vector:pFlc-1
Associated Gene/TranscriptFis1-RA
Protein status:RE29957.pep: gold
Preliminary Size:450
Sequenced Size:641

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17510 2001-12-14 Blastp of sequenced clone
CG17510 2002-01-01 Sim4 clustering to Release 2
CG17510 2003-01-01 Sim4 clustering to Release 3
CG17510 2008-04-29 Release 5.5 accounting
CG17510 2008-08-15 Release 5.9 accounting
CG17510 2008-12-18 5.12 accounting

Clone Sequence Records

RE29957.complete Sequence

641 bp (641 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071264

> RE29957.complete
AGAATGAACGGCTACTCTTGGCGTTAAATTCTCTGTATATAATTTTTGTA
TTTGCTAACAACATTTGCCAAACAATGGAGGATCTTTTAAACGAAGTTGT
ACCACAAGAAGATTTAGAAGTACGCATTCTGTCTGGTCCGAAGTCGGTAC
ACAAATGACGTTAGAAAGGGAATTATGATTTTGGAGGAACTGGCTCGTAC
GCATCCAGATGGAAGGCGTGACTATATATATTATCTTGCGTTTGGTAATG
CTCGTATCAAGGAGTATACGTCTGGCTTAAAATACTGCCGAGCTTTTCTT
GACATCGAGTCAAATGATCAAGTTCGCTCCCTAGAGGAATATATTAAAAA
AGAAATCGATAAGGAAGTGGCAAAGGGTATGGTGGTTGCAGGCGGAGCAG
CTTTAGTACTTGGCGGAATATTAGGACTTGGCATTGCTATGGCTAGAAAT
AAACAAAAACGGGAGAAATAGTAACGTCACCACTATTTAAGGAAAATAAA
ACATCGAAAGGTGCACATCAAGATGTTATGAAGTTTAATACTTGAAATAT
GTTAATTTACTACATCAACATTCTAATTAATCTTTATGTACGGTTAAATC
AATAAATTATCCAATTGTTGCTTGCAAAAAAAAAAAAAAAA

RE29957.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1.c 687 Fis1.c 180..686 118..624 2535 100 Plus
Fis1-RC 865 Fis1-RC 237..742 119..624 2530 100 Plus
Fis1-RE 852 Fis1-RE 208..538 119..449 1655 100 Plus
Fis1-RE 852 Fis1-RE 677..851 450..624 875 100 Plus
Fis1.c 687 Fis1.c 1..119 1..119 595 100 Plus
Fis1-RC 865 Fis1-RC 51..169 1..119 595 100 Plus
Fis1-RE 852 Fis1-RE 22..140 1..119 595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1490960..1491134 624..450 875 100 Minus
chr2R 21145070 chr2R 1491616..1491786 337..167 855 100 Minus
chr2R 21145070 chr2R 1492080..1492201 122..1 610 100 Minus
chr2R 21145070 chr2R 1491273..1491387 449..335 575 100 Minus
chr2R 21145070 chr2R 1491840..1491889 169..120 250 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5603587..5603761 624..450 875 100 Minus
2R 25286936 2R 5604243..5604413 337..167 855 100 Minus
2R 25286936 2R 5604707..5604828 122..1 610 100 Minus
2R 25286936 2R 5603900..5604014 449..335 575 100 Minus
2R 25286936 2R 5604467..5604516 169..120 250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5604786..5604960 624..450 875 100 Minus
2R 25260384 2R 5605442..5605612 337..167 855 100 Minus
2R 25260384 2R 5605906..5606027 122..1 610 100 Minus
2R 25260384 2R 5605099..5605213 449..335 575 100 Minus
2R 25260384 2R 5605666..5605715 169..120 250 100 Minus
Blast to na_te.dros performed 2019-03-16 13:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 710..761 447..498 116 69.2 Plus
1360 3409 1360 1360 3409bp 2817..2865 572..527 112 73.5 Minus

RE29957.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:40 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1491273..1491385 337..449 100 <- Minus
chr2R 1491617..1491784 169..336 100 <- Minus
chr2R 1491841..1491889 120..168 100 <- Minus
chr2R 1492083..1492201 1..119 100   Minus
chr2R 1490959..1491134 450..625 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:14 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 1..47 75..120 97 -> Plus
CG17510-RC 115..465 121..471 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:57 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RC 1..47 75..120 97 -> Plus
Fis1-RC 115..465 121..471 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:52 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RC 1..47 75..120 97 -> Plus
Fis1-RC 115..465 121..471 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:33 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 1..47 75..120 97 -> Plus
CG17510-RC 115..465 121..471 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:13:44 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RC 1..47 75..120 97 -> Plus
Fis1-RC 115..465 121..471 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:33 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RA 1..624 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:57 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 1..624 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:52 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 7..630 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:33 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RA 1..624 1..625 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:13:44 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 7..630 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:40 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5603586..5603761 450..625 99 <- Minus
2R 5603900..5604012 337..449 100 <- Minus
2R 5604244..5604411 169..336 100 <- Minus
2R 5604468..5604516 120..168 100 <- Minus
2R 5604710..5604828 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:40 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5603586..5603761 450..625 99 <- Minus
2R 5603900..5604012 337..449 100 <- Minus
2R 5604244..5604411 169..336 100 <- Minus
2R 5604468..5604516 120..168 100 <- Minus
2R 5604710..5604828 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:40 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5603586..5603761 450..625 99 <- Minus
2R 5603900..5604012 337..449 100 <- Minus
2R 5604244..5604411 169..336 100 <- Minus
2R 5604468..5604516 120..168 100 <- Minus
2R 5604710..5604828 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:52 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491091..1491266 450..625 99 <- Minus
arm_2R 1491405..1491517 337..449 100 <- Minus
arm_2R 1491749..1491916 169..336 100 <- Minus
arm_2R 1491973..1492021 120..168 100 <- Minus
arm_2R 1492215..1492333 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:34 Download gff for RE29957.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5604785..5604960 450..625 99 <- Minus
2R 5605099..5605211 337..449 100 <- Minus
2R 5605443..5605610 169..336 100 <- Minus
2R 5605667..5605715 120..168 100 <- Minus
2R 5605909..5606027 1..119 100   Minus

RE29957.pep Sequence

Translation from 174 to 470

> RE29957.pep
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQV
RSLEEYIKKEIDKEVAKGMVVAGGAALVLGGILGLGIAMARNKQKREK*

RE29957.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16209-PA 99 GF16209-PA 1..98 1..98 368 83.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10856-PA 98 GG10856-PA 1..98 1..98 490 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13566-PA 148 GH13566-PA 57..147 1..91 407 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-PG 98 CG17510-PG 1..98 1..98 495 100 Plus
Fis1-PA 98 CG17510-PA 1..98 1..98 495 100 Plus
Fis1-PC 154 CG17510-PC 57..154 1..98 495 100 Plus
Fis1-PF 92 CG17510-PF 1..91 1..91 459 100 Plus
Fis1-PD 92 CG17510-PD 1..91 1..91 459 100 Plus
Fis1-PE 148 CG17510-PE 57..147 1..91 459 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19554-PA 154 GI19554-PA 57..154 1..98 392 89.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21150-PA 98 GL21150-PA 1..98 1..98 402 90.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14535-PA 154 GA14535-PA 57..154 1..98 402 90.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16506-PA 111 GM16506-PA 14..111 1..98 501 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10356-PA 115 GD10356-PA 18..115 1..98 501 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22057-PA 154 GJ22057-PA 57..154 1..98 380 87.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24945-PA 149 GK24945-PA 57..148 1..91 317 62 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11291-PA 98 GE11291-PA 1..98 1..98 497 99 Plus

RE29957.hyp Sequence

Translation from 174 to 470

> RE29957.hyp
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQV
RSLEEYIKKEIDKEVAKGMVVAGGAALVLGGILGLGIAMARNKQKREK*

RE29957.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-PG 98 CG17510-PG 1..98 1..98 495 100 Plus
Fis1-PA 98 CG17510-PA 1..98 1..98 495 100 Plus
Fis1-PC 154 CG17510-PC 57..154 1..98 495 100 Plus
Fis1-PF 92 CG17510-PF 1..91 1..91 459 100 Plus
Fis1-PD 92 CG17510-PD 1..91 1..91 459 100 Plus