Clone RE30049 Report

Search the DGRC for RE30049

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:300
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG15044-RA
Protein status:RE30049.pep: gold
Preliminary Size:471
Sequenced Size:829

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15044 2001-12-14 Blastp of sequenced clone
CG15044 2002-01-01 Sim4 clustering to Release 2
CG15044 2003-01-01 Sim4 clustering to Release 3
CG15044 2008-04-29 Release 5.5 accounting
CG15044 2008-08-15 Release 5.9 accounting
CG15044 2008-12-18 5.12 accounting

Clone Sequence Records

RE30049.complete Sequence

829 bp (829 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071266

> RE30049.complete
AAAATTTCAAAAAGCGTTCGAATAGTGCATCAGAAAAGGAGTCTACACAC
CCCTTATTCTTCCGATTATTTTGTTTCGTTCCCATTTTTTTTCTGGTGAT
CTGGTGATGTTAACAAAGATGTTCCTAGTGCTCTGCCTGGTGCTGGGCAT
CATGGCATCGGTATCCGGACAGCCACACGCCCGTGCCAGCGATCTCTACT
ATACGGACATAACGCCCGTGACCGACGAAACACGCTACACCACCCTCAAT
CCGGACGCACAGCTGAACGAGATGAACAAGGTGAAGCACTCGAAGGGCAA
CGTGGTCTTCACCGCGGGAAAGCGGGCATCGGGTGACCGACTCATTGTGA
ACCACTACGATGACGACAGCTTTCCCAGTGCCAAGGATGTGGAGGTGCTC
ATGAGCTATCCGGCCGGAGCCAGCACAGGGGTCACGCTGACGAGCATCGA
GGTGTATGTGGACATGACGGCGGACGATGCCGGTGGCTATCTGACCAAGG
GTGGCATCGGTCAGACCAACGTGGAGATTCTGCTGACCTCCAATCAGACG
CGCAGCTTCGTCTACGAGACGTTCATCTATGGGTACTAGGACTGCTCGCC
CAGAACTTTCAGCTACAATAAACGATTCGCTTGGAACCCAACTGTGATCA
TGAACTCCAGACCCTGCCCCTGTCCCTGCCCTTCCTGCCGAGAGTATTAT
TAGTCATAGACGTACATATATTAAAGAATCAAATTTCAAACGGACTACTG
TGCACATCCTTTTACTTATCCGTACCATTGCAGAAATAAAGTGTTCCTTG
TTGCTTGGCGCCCAAAAAAAAAAAAAAAA

RE30049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15044-RA 815 CG15044-RA 1..815 2..816 4045 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18380298..18381109 813..2 3970 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18491182..18491996 816..2 4045 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18499280..18500094 816..2 4045 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 03:21:52 has no hits.

RE30049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:23:05 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18380298..18381109 1..813 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:17 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..483 107..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:11 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..483 107..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:36 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..483 107..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:45 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..483 107..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:43 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..483 107..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:28 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..812 2..813 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:11 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..812 2..813 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:36 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 11..822 1..813 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:45 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 1..812 2..813 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:43 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG15044-RA 11..822 1..813 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:05 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
X 18491185..18491996 1..813 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:05 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
X 18491185..18491996 1..813 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:05 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
X 18491185..18491996 1..813 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:36 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18385218..18386029 1..813 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:05 Download gff for RE30049.complete
Subject Subject Range Query Range Percent Splice Strand
X 18499283..18500094 1..813 99   Minus

RE30049.pep Sequence

Translation from 106 to 588

> RE30049.pep
MLTKMFLVLCLVLGIMASVSGQPHARASDLYYTDITPVTDETRYTTLNPD
AQLNEMNKVKHSKGNVVFTAGKRASGDRLIVNHYDDDSFPSAKDVEVLMS
YPAGASTGVTLTSIEVYVDMTADDAGGYLTKGGIGQTNVEILLTSNQTRS
FVYETFIYGY*

RE30049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22412-PA 162 GF22412-PA 1..162 1..160 593 67.9 Plus
Dana\GF22411-PA 157 GF22411-PA 6..156 5..159 153 29.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18116-PA 156 GG18116-PA 1..156 5..160 742 90.4 Plus
Dere\GG18115-PA 163 GG18115-PA 30..161 33..159 154 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12339-PA 166 GH12339-PA 2..166 7..160 421 50.3 Plus
Dgri\GH12337-PA 162 GH12337-PA 4..160 7..159 176 30.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15044-PA 160 CG15044-PA 1..160 1..160 821 100 Plus
CG15043-PB 163 CG15043-PB 7..161 7..159 153 25.8 Plus
CG15043-PA 163 CG15043-PA 7..161 7..159 153 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15588-PA 170 GI15588-PA 36..170 26..160 458 62.2 Plus
Dmoj\GI15587-PA 164 GI15587-PA 6..162 5..159 164 29.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27029-PA 157 GL27029-PA 1..157 1..160 603 70.6 Plus
Dper\GL27028-PA 166 GL27028-PA 36..164 34..159 160 28.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13456-PA 157 GA13456-PA 1..157 1..160 603 70.6 Plus
Dpse\GA13455-PA 166 GA13455-PA 36..164 34..159 159 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22809-PA 156 GM22809-PA 1..156 5..160 794 95.5 Plus
Dsec\GM22808-PA 163 GM22808-PA 30..161 33..159 140 25.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15632-PA 156 GD15632-PA 1..156 5..160 794 95.5 Plus
Dsim\GD15631-PA 163 GD15631-PA 30..161 33..159 142 26.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15192-PA 140 GJ15192-PA 2..140 22..160 442 58.3 Plus
Dvir\GJ15191-PA 162 GJ15191-PA 4..160 7..159 194 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25258-PA 156 GK25258-PA 1..156 5..160 576 66 Plus
Dwil\GK25257-PA 169 GK25257-PA 6..167 5..159 213 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15521-PA 157 GE15521-PA 1..157 5..160 737 89.2 Plus
Dyak\GE15520-PA 164 GE15520-PA 30..162 33..159 138 25.6 Plus

RE30049.hyp Sequence

Translation from 106 to 588

> RE30049.hyp
MLTKMFLVLCLVLGIMASVSGQPHARASDLYYTDITPVTDETRYTTLNPD
AQLNEMNKVKHSKGNVVFTAGKRASGDRLIVNHYDDDSFPSAKDVEVLMS
YPAGASTGVTLTSIEVYVDMTADDAGGYLTKGGIGQTNVEILLTSNQTRS
FVYETFIYGY*

RE30049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15044-PA 160 CG15044-PA 1..160 1..160 821 100 Plus
CG15043-PB 163 CG15043-PB 7..161 7..159 153 25.8 Plus
CG15043-PA 163 CG15043-PA 7..161 7..159 153 25.8 Plus