Clone RE30174 Report

Search the DGRC for RE30174

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:301
Well:74
Vector:pFlc-1
Associated Gene/TranscriptCG16985-RA
Protein status:RE30174.pep: gold
Preliminary Size:450
Sequenced Size:652

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16985 2001-12-14 Blastp of sequenced clone
CG16985 2002-01-01 Sim4 clustering to Release 2
CG16985 2003-01-01 Sim4 clustering to Release 3
CG16985 2008-04-29 Release 5.5 accounting
CG16985 2008-08-15 Release 5.9 accounting
CG16985 2008-12-18 5.12 accounting

Clone Sequence Records

RE30174.complete Sequence

652 bp (652 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071268

> RE30174.complete
CTCAGTAACTTTCGTCATTTCGTCGTGCTCAGTTCAGGAATCCAAATCCA
CCGGAATGGCGGCCAAGAAACTGGGAATGGACTTTGTGAAGCAGATGTCC
GAGTACGCCAGCGGGTCCAATGGATTCGACCGCGTCTTGAAAATGATTAA
AATTACAGGCGGTGGAGATGGTCGCGCAATAGGGGAGTTCACTGTGGCCA
ATGAGCATTTGAATCGCCAAGGAACTTTGCACGGTGGTCTTACGGCAACA
ATTGTTGATAATTGTACCACATATGCCCTTATGTCGAAAGGATCCCATCC
CGGAGTTACGGCCAACCTGAATGTAAGCTACATTGCAGCAGCGAAACCTG
GCGAACTTATTGAAATTGATTGTAATACCGTGCGGGCCGGTAAGAAAATG
GCCTATTTGGACTGCATTCTGAGGCGTAAGTCCGATGGAAAGATCATCGC
CAAGGGCGGACAGGTCAAGTACATTCAGTTCGACAAGGAAAAACTGGATT
TTTAAAACAATTTTTGTAGATCGTCAGAAAACGAAATAAAATCTTTCGAA
CCTCTGCTTAAGACGTACTAGTTTAATTATTTATTATTTCTTAAGTTAGT
TATTTCTTAATTTACAAAATAAAGATATTTAAAACTAAAAAAAAAAAAAA
AA

RE30174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG16985-RA 649 CG16985-RA 1..640 1..640 3200 100 Plus
CG12182-RA 2368 CG12182-RA 190..269 80..1 400 100 Minus
CG12182-RA 2368 CG12182-RA 70..136 145..79 335 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2599404..2599752 288..636 1745 100 Plus
chr3L 24539361 chr3L 2599197..2599343 145..291 735 100 Plus
chr3L 24539361 chr3L 2598812..2598891 1..80 400 100 Plus
chr3L 24539361 chr3L 2598945..2599011 79..145 335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2599894..2600246 288..640 1765 100 Plus
3L 28110227 3L 2599687..2599833 145..291 735 100 Plus
3L 28110227 3L 2599302..2599381 1..80 400 100 Plus
3L 28110227 3L 2599435..2599501 79..145 335 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2599894..2600246 288..640 1765 100 Plus
3L 28103327 3L 2599687..2599833 145..291 735 100 Plus
3L 28103327 3L 2599302..2599381 1..80 400 100 Plus
3L 28103327 3L 2599435..2599501 79..145 335 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:18:12 has no hits.

RE30174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:19:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2598812..2598890 1..79 100 -> Plus
chr3L 2598946..2599011 80..145 100 -> Plus
chr3L 2599198..2599342 146..290 100 -> Plus
chr3L 2599407..2599687 291..571 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:24 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..450 56..505 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:29:38 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..450 56..505 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:26:12 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..450 56..505 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:19:54 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..450 56..505 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..450 56..505 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:59:06 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:29:38 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:26:12 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 6..641 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:19:54 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
CG16985-RA 6..641 1..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599302..2599380 1..79 100 -> Plus
3L 2599436..2599501 80..145 100 -> Plus
3L 2599688..2599832 146..290 100 -> Plus
3L 2599897..2600242 291..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599302..2599380 1..79 100 -> Plus
3L 2599436..2599501 80..145 100 -> Plus
3L 2599688..2599832 146..290 100 -> Plus
3L 2599897..2600242 291..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:07 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599302..2599380 1..79 100 -> Plus
3L 2599436..2599501 80..145 100 -> Plus
3L 2599688..2599832 146..290 100 -> Plus
3L 2599897..2600242 291..636 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:26:12 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2599302..2599380 1..79 100 -> Plus
arm_3L 2599436..2599501 80..145 100 -> Plus
arm_3L 2599688..2599832 146..290 100 -> Plus
arm_3L 2599897..2600242 291..636 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:53:32 Download gff for RE30174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599897..2600242 291..636 100   Plus
3L 2599302..2599380 1..79 100 -> Plus
3L 2599436..2599501 80..145 100 -> Plus
3L 2599688..2599832 146..290 100 -> Plus

RE30174.hyp Sequence

Translation from 0 to 504

> RE30174.hyp
SVTFVISSCSVQESKSTGMAAKKLGMDFVKQMSEYASGSNGFDRVLKMIK
ITGGGDGRAIGEFTVANEHLNRQGTLHGGLTATIVDNCTTYALMSKGSHP
GVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKIIA
KGGQVKYIQFDKEKLDF*

RE30174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG16985-PA 149 CG16985-PA 1..149 19..167 768 100 Plus
CG16986-PB 143 CG16986-PB 1..143 19..161 330 44.1 Plus
CG16986-PA 143 CG16986-PA 1..143 19..161 330 44.1 Plus

RE30174.pep Sequence

Translation from 55 to 504

> RE30174.pep
MAAKKLGMDFVKQMSEYASGSNGFDRVLKMIKITGGGDGRAIGEFTVANE
HLNRQGTLHGGLTATIVDNCTTYALMSKGSHPGVTANLNVSYIAAAKPGE
LIEIDCNTVRAGKKMAYLDCILRRKSDGKIIAKGGQVKYIQFDKEKLDF*

RE30174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24237-PA 153 GF24237-PA 1..149 1..149 587 71.1 Plus
Dana\GF24238-PA 143 GF24238-PA 1..143 1..143 334 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14875-PA 149 GG14875-PA 1..149 1..149 770 97.3 Plus
Dere\GG14876-PA 143 GG14876-PA 1..143 1..143 332 43.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16393-PA 146 GH16393-PA 1..144 1..145 501 62.1 Plus
Dgri\GH16394-PA 143 GH16394-PA 1..142 1..142 406 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG16985-PA 149 CG16985-PA 1..149 1..149 768 100 Plus
CG16986-PB 143 CG16986-PB 1..143 1..143 330 44.1 Plus
CG16986-PA 143 CG16986-PA 1..143 1..143 330 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12476-PA 139 GI12476-PA 1..136 10..145 524 66.9 Plus
Dmoj\GI12477-PA 143 GI12477-PA 1..142 1..142 395 52.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22458-PA 145 GL22458-PA 4..144 5..145 616 78.7 Plus
Dper\GL22459-PA 133 GL22459-PA 15..133 31..149 473 73.9 Plus
Dper\GL22460-PA 90 GL22460-PA 1..78 1..78 187 48.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14257-PA 145 GA14257-PA 4..144 5..145 619 79.4 Plus
Dpse\GA24343-PA 148 GA24343-PA 1..148 1..149 546 68.5 Plus
Dpse\GA14258-PA 144 GA14258-PA 1..142 1..142 342 45.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15031-PA 149 GM15031-PA 1..149 1..149 775 98 Plus
Dsec\GM14498-PA 149 GM14498-PA 1..149 1..149 775 98 Plus
Dsec\GM14499-PA 96 GM14499-PA 1..96 54..149 506 99 Plus
Dsec\GM15032-PA 143 GM15032-PA 1..143 1..143 333 43.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13695-PA 149 GD13695-PA 1..149 1..149 779 98.7 Plus
Dsim\GD13696-PA 143 GD13696-PA 1..143 1..143 333 43.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12377-PA 135 GJ12377-PA 1..134 10..143 503 66.4 Plus
Dvir\GJ12379-PA 144 GJ12379-PA 1..144 1..144 407 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12657-PA 144 GK12657-PA 1..143 1..143 563 68.5 Plus
Dwil\GK12658-PA 143 GK12658-PA 1..143 1..143 402 50.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20327-PA 149 GE20327-PA 1..149 1..149 770 97.3 Plus
Dyak\GE20328-PA 143 GE20328-PA 1..143 1..143 332 43.4 Plus