Clone RE30284 Report

Search the DGRC for RE30284

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:302
Well:84
Vector:pFlc-1
Associated Gene/Transcriptgk-RB
Protein status:RE30284.pep: gold
Preliminary Size:237
Sequenced Size:1332

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13695 2001-12-14 Blastp of sequenced clone
CG13695 2002-01-01 Sim4 clustering to Release 2
CG13695 2003-01-01 Sim4 clustering to Release 3
gk 2008-04-29 Release 5.5 accounting
gk 2008-08-15 Release 5.9 accounting
gk 2008-12-18 5.12 accounting

Clone Sequence Records

RE30284.complete Sequence

1332 bp (1332 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071271

> RE30284.complete
AGTGACATCGCAACTTTTGGACGAATCGGACGTACCGCTCCATATCGTCG
TTATATCTTAGTACCTGTTGCTTTCGCGTGTGTTACCTGTATCTGTATTT
TGGTTTTACAGTTACTAACGAGTTATGTGCGCTTGAATGCCAAATTTAAT
TGCCGCTCTTTGCATGTTCGTCAGCAACAATTTGAAAACGTTTTCGTAAA
GCGATTAAGAAACTACTTTCGTTTTTCCCCCCAACTTTCCATTTTCTTGC
TCGTCGGCTTGCCATTGAAAAAAGTGTCAAAACCCAGGTGCTAACAAACC
AAAGCAGAGATCAAACATCTGAAAGAAAAAAATACCGAAAACTATAAAGT
TGTGAAACGCTTGTGAATTGATACAGTTTTATATTATGGCTCTCATTGAC
ACCGCCTGGCGTTGTCGCCTCATGATCTTCGTTATCGTCTCGCTGCTCCT
TGTGGGCGATCTTTTTGGATACGGCGGCGGCATGAAGTCCAACCACCCCA
ATCCGCACTCGGTAAGATCGGCGCGGGGCGCGGTGCCGGGTGGTGCCCCA
ACGGGTCCGGCGGCTGCAGCGGCCAGCAAGTTCCAGACCAAAAATGCCGA
AATCGACATAACTGAAGAGCACGATTTCAATGAACTCTCAGCAGCAGCTC
AATCCCTCAAGCCTGGAATGGCAGTGGTTACTGGGGCTAGTCTGAAGACC
AAGTCCCAACTCACGGACGCCATCAAGGAATCATGTCTCCCCAAGATGCT
CTGCGAACTGGCCTCCAAGGCGGATTACCAACTCAGCGAAAAGGAGCGGG
AACTGCTAAGACTGATCAGATCTCCAACAATGCCCTGGATGATGAACATG
CCGCCGAGCAAATGGTATTTTGCGGCCCACATGGGCGAACTCATGCGTCA
CACTGGCGACAATCTCAGCGGACCTATGGGGTGCGCCAATCTCTGGCCAA
ATTGCCCGATCAGCTCCAAGAAGCTGATGAAGCTCAGCTACAAAGTGAGG
GTCTAGCCACTGGATCCGAACCTTAAGTATTAGGATGTAGGCGACCCCCC
TCAACTTTTGTACCATATGTCTTCTCACCGTTCGATAAGCTTATCTTGTA
AATTACCTTGTAAATTAGATCTAAGTACCGACTTGACTGAAGTGACTGTA
GAACTGTAACCTCTTGTATCTGTATCTACTGGCTACAAGATCTAGGTAGC
TTGTAATTACATATAGTACGTGTGACTAGTCACGATCCGATTTAGCATTA
CGCCTAGTCGTTAGTTGGATGCTCCTGTAATTGTTAATAAATTACACTCT
GGTGTGCAAACTCCCCAAAAAAAAAAAAAAAA

RE30284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
gk-RB 1561 gk-RB 37..1354 1..1318 6560 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18129077..18129693 1..617 3070 99.8 Plus
chr3L 24539361 chr3L 18134570..18135069 817..1316 2470 99.6 Plus
chr3L 24539361 chr3L 18133150..18133353 616..819 1020 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18139404..18140020 1..617 3070 99.8 Plus
3L 28110227 3L 18144919..18145420 817..1318 2495 99.8 Plus
3L 28110227 3L 18143500..18143703 616..819 1020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18132504..18133120 1..617 3070 99.8 Plus
3L 28103327 3L 18138019..18138520 817..1318 2495 99.8 Plus
3L 28103327 3L 18136600..18136803 616..819 1020 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:53:53 has no hits.

RE30284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:54:42 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18129077..18129693 1..617 99 -> Plus
chr3L 18133152..18133353 618..819 100 -> Plus
chr3L 18134573..18135069 820..1316 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:33 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..621 386..1006 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:40 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..621 386..1006 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:12 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..621 386..1006 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:38:16 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..621 386..1006 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:12 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..621 386..1006 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:59 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..1316 1..1316 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:40 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..1316 1..1316 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:12 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 3..1318 1..1316 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:38:16 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 1..1316 1..1316 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:12 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
gk-RB 3..1318 1..1316 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:42 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18139404..18140020 1..617 99 -> Plus
3L 18143502..18143703 618..819 100 -> Plus
3L 18144922..18145418 820..1316 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:42 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18139404..18140020 1..617 99 -> Plus
3L 18143502..18143703 618..819 100 -> Plus
3L 18144922..18145418 820..1316 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:42 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18139404..18140020 1..617 99 -> Plus
3L 18143502..18143703 618..819 100 -> Plus
3L 18144922..18145418 820..1316 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:12 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18132504..18133120 1..617 99 -> Plus
arm_3L 18136602..18136803 618..819 100 -> Plus
arm_3L 18138022..18138518 820..1316 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:30 Download gff for RE30284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18132504..18133120 1..617 99 -> Plus
3L 18136602..18136803 618..819 100 -> Plus
3L 18138022..18138518 820..1316 99   Plus

RE30284.hyp Sequence

Translation from 385 to 1005

> RE30284.hyp
MALIDTAWRCRLMIFVIVSLLLVGDLFGYGGGMKSNHPNPHSVRSARGAV
PGGAPTGPAAAAASKFQTKNAEIDITEEHDFNELSAAAQSLKPGMAVVTG
ASLKTKSQLTDAIKESCLPKMLCELASKADYQLSEKERELLRLIRSPTMP
WMMNMPPSKWYFAAHMGELMRHTGDNLSGPMGCANLWPNCPISSKKLMKL
SYKVRV*

RE30284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
gk-PB 206 CG13695-PB 1..206 1..206 1081 100 Plus

RE30284.pep Sequence

Translation from 385 to 1005

> RE30284.pep
MALIDTAWRCRLMIFVIVSLLLVGDLFGYGGGMKSNHPNPHSVRSARGAV
PGGAPTGPAAAAASKFQTKNAEIDITEEHDFNELSAAAQSLKPGMAVVTG
ASLKTKSQLTDAIKESCLPKMLCELASKADYQLSEKERELLRLIRSPTMP
WMMNMPPSKWYFAAHMGELMRHTGDNLSGPMGCANLWPNCPISSKKLMKL
SYKVRV*

RE30284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23616-PA 209 GF23616-PA 1..209 1..206 829 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13652-PA 206 GG13652-PA 1..206 1..206 936 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14449-PA 207 GH14449-PA 1..207 1..206 833 78.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
geko-PB 206 CG13695-PB 1..206 1..206 1081 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13584-PA 202 GI13584-PA 1..202 1..206 781 74.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22865-PA 217 GL22865-PA 1..217 1..206 865 82.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12465-PA 217 GA12465-PA 1..217 1..206 865 82.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14967-PA 204 GM14967-PA 1..167 1..167 729 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14747-PA 206 GD14747-PA 1..206 1..206 960 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13922-PA 203 GJ13922-PA 1..203 1..206 864 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11100-PA 214 GK11100-PA 1..214 1..206 792 76.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19950-PA 206 GE19950-PA 1..205 1..205 925 91.7 Plus