Clone RE30346 Report

Search the DGRC for RE30346

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:303
Well:46
Vector:pFlc-1
Associated Gene/TranscriptCG6000-RB
Protein status:RE30346.pep: wuzgold
Preliminary Size:447
Sequenced Size:543

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6000 2001-12-14 Blastp of sequenced clone
CG6000 2002-01-01 Sim4 clustering to Release 2
CG6000 2003-01-01 Sim4 clustering to Release 3
CG6000 2008-04-29 Release 5.5 accounting
CG6000 2008-08-15 Release 5.9 accounting
CG6000 2008-12-18 5.12 accounting

Clone Sequence Records

RE30346.complete Sequence

543 bp (543 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071272

> RE30346.complete
ATTCATTTGTTGTTCTCTGTGATTTTACGTAATATTGCCAGGCTCCTCAA
ATTGGAATCGTGGACTACGACGTGGTCAAGAAACTACCCAGCGAACCACA
GAAACTGCTCATCGATGTCCGGGAGCCGGAAGAGCTGAAGGAAACCGGAC
AAATCCCCGCCAGCATCAACATCCCTCTGGGCGTGGTTAGTCAGGAATTG
GCGGCCAGTGAGCAGCTTTTTAAATCCAAATATGGCCGGGAAAAACCGAA
GCCAGAAACGGAGATTATATTCCACTGCAAGATTGGCAAAAGAAGCCTTA
AGGCTGCAGAAGCTGCCGCCGCATTGGGATTCAAGAATGTAAAGAACTAC
CAGGGATCTTGGCTGGATTGGGCCGAACGAGAGGGCCTGCCCAAGTAAAT
AACATTGCTATGCGAATAATGACATTATCCATCTGGTTAATCCATTATTT
TGCAACAATAATTCCATTTCGCCCAAACAACCCGATTACTCATTTTTAAA
AATAAACACATTTTATGTGCTTTGGCAAGTTAAAAAAAAAAAA

RE30346.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6000-RB 573 CG6000-RB 35..566 1..532 2660 100 Plus
CG6000.b 537 CG6000.b 3..530 1..532 2575 99.2 Plus
CG6000.a 571 CG6000.a 70..564 38..532 2475 100 Plus
CG6000.a 571 CG6000.a 42..69 1..28 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19878012..19878489 37..513 2280 99 Plus
chr3R 27901430 chr3R 19877832..19877868 1..37 185 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24054598..24055093 37..532 2480 100 Plus
3R 32079331 3R 24054418..24054454 1..37 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23795429..23795924 37..532 2480 100 Plus
3R 31820162 3R 23795249..23795285 1..37 185 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:42:18 has no hits.

RE30346.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:43:05 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19877832..19877868 1..37 100 -> Plus
chr3R 19878013..19878492 38..520 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:34 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RA 82..447 33..398 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:25 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RA 82..447 33..398 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:11 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RD 100..465 33..398 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:40 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RA 82..447 33..398 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:43 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RD 100..465 33..398 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:32 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RB 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:25 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RB 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:11 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RD 28..64 1..37 100 -> Plus
CG6000-RD 209..702 38..531 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:40 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RB 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:43 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
CG6000-RD 28..64 1..37 100 -> Plus
CG6000-RD 209..702 38..531 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24054418..24054454 1..37 100 -> Plus
3R 24054599..24055092 38..531 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24054418..24054454 1..37 100 -> Plus
3R 24054599..24055092 38..531 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24054418..24054454 1..37 100 -> Plus
3R 24054599..24055092 38..531 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:11 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19880140..19880176 1..37 100 -> Plus
arm_3R 19880321..19880814 38..531 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:17 Download gff for RE30346.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23795430..23795923 38..531 100   Plus
3R 23795249..23795285 1..37 100 -> Plus

RE30346.hyp Sequence

Translation from 0 to 137

> RE30346.hyp
IHLLFSVILRNIARLLKLESWTTTWSRNYPANHRNCSSMSGSRKS*
Sequence RE30346.hyp has no blast hits.

RE30346.pep Sequence

Translation from 231 to 341

> RE30346.pep
MAGKNRSQKRRLYSTARLAKEALRLQKLPPHWDSRM*
Sequence RE30346.pep has no blast hits.