RE30346.complete Sequence
543 bp (543 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071272
> RE30346.complete
ATTCATTTGTTGTTCTCTGTGATTTTACGTAATATTGCCAGGCTCCTCAA
ATTGGAATCGTGGACTACGACGTGGTCAAGAAACTACCCAGCGAACCACA
GAAACTGCTCATCGATGTCCGGGAGCCGGAAGAGCTGAAGGAAACCGGAC
AAATCCCCGCCAGCATCAACATCCCTCTGGGCGTGGTTAGTCAGGAATTG
GCGGCCAGTGAGCAGCTTTTTAAATCCAAATATGGCCGGGAAAAACCGAA
GCCAGAAACGGAGATTATATTCCACTGCAAGATTGGCAAAAGAAGCCTTA
AGGCTGCAGAAGCTGCCGCCGCATTGGGATTCAAGAATGTAAAGAACTAC
CAGGGATCTTGGCTGGATTGGGCCGAACGAGAGGGCCTGCCCAAGTAAAT
AACATTGCTATGCGAATAATGACATTATCCATCTGGTTAATCCATTATTT
TGCAACAATAATTCCATTTCGCCCAAACAACCCGATTACTCATTTTTAAA
AATAAACACATTTTATGTGCTTTGGCAAGTTAAAAAAAAAAAA
RE30346.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:45:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6000-RB | 573 | CG6000-RB | 35..566 | 1..532 | 2660 | 100 | Plus |
CG6000.b | 537 | CG6000.b | 3..530 | 1..532 | 2575 | 99.2 | Plus |
CG6000.a | 571 | CG6000.a | 70..564 | 38..532 | 2475 | 100 | Plus |
CG6000.a | 571 | CG6000.a | 42..69 | 1..28 | 140 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:42:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 19878012..19878489 | 37..513 | 2280 | 99 | Plus |
chr3R | 27901430 | chr3R | 19877832..19877868 | 1..37 | 185 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24054598..24055093 | 37..532 | 2480 | 100 | Plus |
3R | 32079331 | 3R | 24054418..24054454 | 1..37 | 185 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 23795429..23795924 | 37..532 | 2480 | 100 | Plus |
3R | 31820162 | 3R | 23795249..23795285 | 1..37 | 185 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 22:42:18 has no hits.
RE30346.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:43:05 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 19877832..19877868 | 1..37 | 100 | -> | Plus |
chr3R | 19878013..19878492 | 38..520 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:34 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RA | 82..447 | 33..398 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:25 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RA | 82..447 | 33..398 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:11 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RD | 100..465 | 33..398 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:40 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RA | 82..447 | 33..398 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:43 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RD | 100..465 | 33..398 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:32 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RB | 1..531 | 1..531 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:25 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RB | 1..531 | 1..531 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:11 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RD | 28..64 | 1..37 | 100 | -> | Plus |
CG6000-RD | 209..702 | 38..531 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:40 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RB | 1..531 | 1..531 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:43 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6000-RD | 28..64 | 1..37 | 100 | -> | Plus |
CG6000-RD | 209..702 | 38..531 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24054418..24054454 | 1..37 | 100 | -> | Plus |
3R | 24054599..24055092 | 38..531 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24054418..24054454 | 1..37 | 100 | -> | Plus |
3R | 24054599..24055092 | 38..531 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:43:05 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24054418..24054454 | 1..37 | 100 | -> | Plus |
3R | 24054599..24055092 | 38..531 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:11 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19880140..19880176 | 1..37 | 100 | -> | Plus |
arm_3R | 19880321..19880814 | 38..531 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:17 Download gff for
RE30346.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23795430..23795923 | 38..531 | 100 | | Plus |
3R | 23795249..23795285 | 1..37 | 100 | -> | Plus |
RE30346.hyp Sequence
Translation from 0 to 137
> RE30346.hyp
IHLLFSVILRNIARLLKLESWTTTWSRNYPANHRNCSSMSGSRKS*
Sequence RE30346.hyp has no blast hits.
RE30346.pep Sequence
Translation from 231 to 341
> RE30346.pep
MAGKNRSQKRRLYSTARLAKEALRLQKLPPHWDSRM*
Sequence RE30346.pep has no blast hits.