Clone RE30433 Report

Search the DGRC for RE30433

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:304
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG4306-RA
Protein status:RE30433.pep: gold
Preliminary Size:1016
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4306 2001-12-17 Blastp of sequenced clone
CG4306 2002-01-01 Sim4 clustering to Release 2
CG4306 2003-01-01 Sim4 clustering to Release 3
CG4306 2008-04-29 Release 5.5 accounting
CG4306 2008-08-15 Release 5.9 accounting
CG4306 2008-12-18 5.12 accounting

Clone Sequence Records

RE30433.complete Sequence

1041 bp (1041 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071274

> RE30433.complete
GTAGACGTTCAACCTGAAGGCAGATCGTATCGCTTGGAGCTGTCAAGTCT
AAATAAATATATTCATATATACGGGTATACATTTATAGAATGAACTACGA
GTGTCTTATCGGTGTTCTAAGCTGCCTATTGGTAGCTCTCCCCAAAGGAA
ATTGCCACAGCATCAGTGGTTTAAATTCCACCTTGAATCTACCAGAGATT
CGAGGTGACCAGTTCCTGTACTTTGGATTCGGAAGCAATATGCTGATCAA
GAGAATTCACATCCAGAACCCTTCGGCGGTAAGAATTGGTCCGGCCCTGC
TACCCGATTATCGATTGGACTTTGCCTTGGAATCAGCCGGTTGGAGCGGT
TCTGTGGCCACCATCGTTCCCACCCAGGGTGATCATGTCTGGGGAACCCT
CTGGAAGATCGATCTAAGTAATCTGCCGGATATAGACAGTCAAGAAGGCG
TTAGTCAAGGCATTTATGAGCCTCGCACCGTTTACGTAAAACTCCATGGG
GAATCTGAATCAACTCCTGCCCGAGCTTATCTACTGACCAAGCAGCCAGA
GAGCAATCTGTACGAACTGCCTAAGGACTCCATTCCCTTATCCAGACAGC
CCTCGAAAACATATCTGCAATGTCTCGTTAAAGGCGCTATTGAGAGCTCC
GTTCCGGAGGATTATGTTCAGCGATTGAGGAGCATTAAGCATAATGGACA
AGTTAACTCCTATCTGGAACGAAAACTGGAACTGGGAGGGGTAACCCTTT
AAGTAATCAAAACATTAAATAAATTTCATAGTGCCTTTGACATTTTTATC
AAAGATTTCTGAAAATATGTGGAGATTCACCTAAATAATACAATATTAAT
CAATACGTTTAATAACTAAATTATCGTCTTTATTGTTACACTGCAGCCAT
GAATGAATGAATCTTTGAATCTTTTGTAATAACATTCAAATTGTGCCATG
TAATATTGCTACGCGAAATAAATCGCTTAAATCCATTTTAGTTTTATTTT
ACCAATAAATGTCTTCTTGTGCCACAAAAAAAAAAAAAAAA

RE30433.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4306-RA 1219 CG4306-RA 131..1153 1..1023 5115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18451558..18452144 1023..437 2935 100 Minus
chr3L 24539361 chr3L 18452301..18452739 439..1 2180 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18461957..18462543 1023..437 2935 100 Minus
3L 28110227 3L 18462719..18463157 439..1 2195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18455057..18455643 1023..437 2935 100 Minus
3L 28103327 3L 18455819..18456257 439..1 2195 100 Minus
Blast to na_te.dros performed 2019-03-16 22:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 4145..4262 743..864 114 58.5 Plus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3360..3429 836..769 110 65.7 Minus

RE30433.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:52:08 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18451556..18452141 440..1025 99 <- Minus
chr3L 18452301..18452739 1..439 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:37 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..663 90..752 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:26 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..663 90..752 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:17:01 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..663 90..752 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:10 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..663 90..752 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:43:54 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..663 90..752 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:26 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:26 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:17:01 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 7..1029 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:10 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 1..1025 1..1025 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:43:54 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
CG4306-RA 7..1029 1..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:52:08 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18461955..18462540 440..1025 99 <- Minus
3L 18462719..18463157 1..439 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:52:08 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18461955..18462540 440..1025 99 <- Minus
3L 18462719..18463157 1..439 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:52:08 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18461955..18462540 440..1025 99 <- Minus
3L 18462719..18463157 1..439 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:17:01 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18455055..18455640 440..1025 99 <- Minus
arm_3L 18455819..18456257 1..439 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:13 Download gff for RE30433.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18455055..18455640 440..1025 99 <- Minus
3L 18455819..18456257 1..439 100   Minus

RE30433.hyp Sequence

Translation from 89 to 751

> RE30433.hyp
MNYECLIGVLSCLLVALPKGNCHSISGLNSTLNLPEIRGDQFLYFGFGSN
MLIKRIHIQNPSAVRIGPALLPDYRLDFALESAGWSGSVATIVPTQGDHV
WGTLWKIDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESESTPARAYLLT
KQPESNLYELPKDSIPLSRQPSKTYLQCLVKGAIESSVPEDYVQRLRSIK
HNGQVNSYLERKLELGGVTL*

RE30433.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4306-PA 220 CG4306-PA 1..220 1..220 1149 100 Plus
CG32196-PB 195 CG32196-PB 15..194 42..220 479 54.4 Plus
CG32196-PC 154 CG32196-PC 3..153 71..220 371 51 Plus

RE30433.pep Sequence

Translation from 89 to 751

> RE30433.pep
MNYECLIGVLSCLLVALPKGNCHSISGLNSTLNLPEIRGDQFLYFGFGSN
MLIKRIHIQNPSAVRIGPALLPDYRLDFALESAGWSGSVATIVPTQGDHV
WGTLWKIDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESESTPARAYLLT
KQPESNLYELPKDSIPLSRQPSKTYLQCLVKGAIESSVPEDYVQRLRSIK
HNGQVNSYLERKLELGGVTL*

RE30433.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10818-PA 229 GF10818-PA 1..229 1..220 818 68.6 Plus
Dana\GF10819-PA 172 GF10819-PA 1..171 51..220 403 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15742-PA 220 GG15742-PA 1..220 1..220 1017 86.4 Plus
Dere\GG15743-PA 208 GG15743-PA 1..161 51..215 431 53.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17111-PA 220 GH17111-PA 25..218 28..220 620 61.9 Plus
Dgri\GH23200-PA 220 GH23200-PA 25..218 28..220 616 61.9 Plus
Dgri\GH23201-PA 186 GH23201-PA 4..185 41..220 449 50.5 Plus
Dgri\GH17112-PA 186 GH17112-PA 4..185 41..220 446 50.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4306-PA 220 CG4306-PA 1..220 1..220 1149 100 Plus
CG32196-PB 195 CG32196-PB 15..194 42..220 479 54.4 Plus
CG32196-PC 154 CG32196-PC 3..153 71..220 371 51 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11714-PA 213 GI11714-PA 1..213 1..220 564 52 Plus
Dmoj\GI11715-PA 190 GI11715-PA 2..189 39..220 452 51.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22703-PA 196 GL22703-PA 1..195 1..220 494 50 Plus
Dper\GL22704-PA 173 GL22704-PA 1..172 51..220 434 51.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18096-PA 237 GA18096-PA 1..236 1..220 701 60.2 Plus
Dpse\GA16751-PA 173 GA16751-PA 1..172 51..220 434 51.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14939-PA 169 GM14939-PA 10..169 61..220 696 85.6 Plus
Dsec\GM14941-PA 172 GM14941-PA 1..171 51..220 452 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12343-PA 218 GD12343-PA 3..218 5..220 1052 93.1 Plus
Dsim\GD12344-PA 172 GD12344-PA 1..171 51..220 451 53.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11390-PA 217 GJ11390-PA 1..217 7..220 572 52.5 Plus
Dvir\GJ11391-PA 172 GJ11391-PA 1..171 51..220 425 51.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11527-PA 227 GK11527-PA 1..227 1..220 672 59.5 Plus
Dwil\GK11538-PA 192 GK11538-PA 4..191 41..220 485 51.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22074-PA 220 GE22074-PA 1..220 1..220 1001 84.1 Plus
Dyak\GE22075-PA 196 GE22075-PA 1..166 51..220 435 53.2 Plus