Clone RE30473 Report

Search the DGRC for RE30473

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:304
Well:73
Vector:pFlc-1
Associated Gene/TranscriptCG13827-RA
Protein status:RE30473.pep: gold
Preliminary Size:630
Sequenced Size:1001

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13827 2002-01-01 Sim4 clustering to Release 2
CG13827 2002-04-21 Blastp of sequenced clone
CG13827 2003-01-01 Sim4 clustering to Release 3
CG13827 2008-04-29 Release 5.5 accounting
CG13827 2008-08-15 Release 5.9 accounting
CG13827 2008-12-18 5.12 accounting

Clone Sequence Records

RE30473.complete Sequence

1001 bp (1001 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113446

> RE30473.complete
GTTGGATTCCCGAGCGCTCTTGACAATTTCTTGTATTTTCGCTGCGGTAT
CTCAGTTCGAGTTTTTACGTGATATAAAACAGTACCTGGTCTTCAAAAAA
CGAGCCATTATGGGCACCACGACAAAGTTTGTGAACGAGTTCTGTGATAT
TATCGATTCCTATGGCGGGCGAGATAAGGTGATGAAGGCATTGTGCTACA
GTGCCAAACTGGTGGCTGGCTACCATGCCAAGCGGAATCCGGAACTAGCC
AAGCGATACGCCACCGCCAGCTCAAGGATCTCAGGTGCGAGAGCCACACT
GCGTCTCATCGACGACATACCCATGATCCAATATGCTTTGGAGTATGGCT
TGGGCGAGAATGAGCCCGATCGCGTCATGCAAGTGCTGGGAGTGACGGCC
AACATTGTGGATTTGCTCTACTATCCCATCGAGAAGGTGTGCTGGCTGGC
CGAGCACAAGATTGTGGATGTCAAGAATGCGGATAACTGGGACAATGTCA
ACTCCATATTCTGGGTGCTTTCGGTGTACCTGAACCTCATGAGGACAATG
CGGAATTTTTCACTGAATCAGGAAAAGCTGAACCGAACGAATAATATAAA
CGAATTGGATGTGAAAACGTTGACCAAGCACCGCCTGGAGATGGTGTCCA
TCGTTCGGATCTCACTCGACTTTGTGCACGCCGTCAGCACGCTGCCGAAA
GGATATTTGTGGGGCGGCAAGCTGTCCACCCTGCAGGTGGGTGCTATTGG
CACCTTATCCGCTGGCCTGGGCATCTACCAGATCTTTGCCAAGAGAAGAC
TGAACAAGTAGTCGGTCCGCCGTTGTATTTGCAATCCGTGTACTCGTATT
TGTTGAACAGAATTTTAAGCTAGTCGGTAATCGTTTTTGTACGTTGAGTT
TTTTGTACGGCACTCGAAAGTGTGTTTAGCCAGTATGTCCTTTAAAGTAG
CACAAAATACACGCTGAATAATTGTAAAAAACATGAAAAAAAAAAAAAAA
A

RE30473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13827.c 1949 CG13827.c 63..1048 1..986 4930 100 Plus
CG13827.d 1362 CG13827.d 63..1048 1..986 4930 100 Plus
CG13827-RA 1362 CG13827-RA 63..1048 1..986 4930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19083633..19084014 604..985 1910 100 Plus
chr3R 27901430 chr3R 19083087..19083454 177..544 1840 100 Plus
chr3R 27901430 chr3R 19081781..19081960 1..180 900 100 Plus
chr3R 27901430 chr3R 19083512..19083573 542..603 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23260221..23260603 604..986 1915 100 Plus
3R 32079331 3R 23259675..23260042 177..544 1840 100 Plus
3R 32079331 3R 23258369..23258548 1..180 900 100 Plus
3R 32079331 3R 23260100..23260161 542..603 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23001052..23001434 604..986 1915 100 Plus
3R 31820162 3R 23000506..23000873 177..544 1840 100 Plus
3R 31820162 3R 22999200..22999379 1..180 900 100 Plus
3R 31820162 3R 23000931..23000992 542..603 310 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:10:38 has no hits.

RE30473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:39 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19081781..19081958 1..178 100 -> Plus
chr3R 19083089..19083453 179..543 100 -> Plus
chr3R 19083514..19083573 544..603 100 -> Plus
chr3R 19083633..19084014 604..985 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:39 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..702 110..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:57 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..702 110..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:58:40 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..702 110..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:15 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..702 110..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:37 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..702 110..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:49 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..985 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:56 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..985 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:58:40 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 5..989 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:15 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 1..985 1..985 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:37 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
CG13827-RA 5..989 1..985 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:39 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23258369..23258546 1..178 100 -> Plus
3R 23259677..23260041 179..543 100 -> Plus
3R 23260102..23260161 544..603 100 -> Plus
3R 23260221..23260602 604..985 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:39 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23258369..23258546 1..178 100 -> Plus
3R 23259677..23260041 179..543 100 -> Plus
3R 23260102..23260161 544..603 100 -> Plus
3R 23260221..23260602 604..985 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:39 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23258369..23258546 1..178 100 -> Plus
3R 23259677..23260041 179..543 100 -> Plus
3R 23260102..23260161 544..603 100 -> Plus
3R 23260221..23260602 604..985 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:58:40 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19084091..19084268 1..178 100 -> Plus
arm_3R 19085399..19085763 179..543 100 -> Plus
arm_3R 19085824..19085883 544..603 100 -> Plus
arm_3R 19085943..19086324 604..985 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:24 Download gff for RE30473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23000508..23000872 179..543 100 -> Plus
3R 23000933..23000992 544..603 100 -> Plus
3R 23001052..23001433 604..985 100   Plus
3R 22999200..22999377 1..178 100 -> Plus

RE30473.hyp Sequence

Translation from 0 to 810

> RE30473.hyp
LDSRALLTISCIFAAVSQFEFLRDIKQYLVFKKRAIMGTTTKFVNEFCDI
IDSYGGRDKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATL
RLIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIVDLLYYPIEKVCWLA
EHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNFSLNQEKLNRTNNIN
ELDVKTLTKHRLEMVSIVRISLDFVHAVSTLPKGYLWGGKLSTLQVGAIG
TLSAGLGIYQIFAKRRLNK*

RE30473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13827-PA 233 CG13827-PA 1..233 37..269 1202 100 Plus
CG13827-PB 234 CG13827-PB 24..234 59..269 1081 100 Plus
CG33474-PB 201 CG33474-PB 3..201 42..269 415 39 Plus
CG33474-PA 201 CG33474-PA 3..201 42..269 415 39 Plus

RE30473.pep Sequence

Translation from 109 to 810

> RE30473.pep
MGTTTKFVNEFCDIIDSYGGRDKVMKALCYSAKLVAGYHAKRNPELAKRY
ATASSRISGARATLRLIDDIPMIQYALEYGLGENEPDRVMQVLGVTANIV
DLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMRTMRNF
SLNQEKLNRTNNINELDVKTLTKHRLEMVSIVRISLDFVHAVSTLPKGYL
WGGKLSTLQVGAIGTLSAGLGIYQIFAKRRLNK*

RE30473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16987-PA 233 GF16987-PA 1..233 1..233 1183 94 Plus
Dana\GF12123-PA 217 GF12123-PA 1..214 1..230 768 62.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11196-PA 233 GG11196-PA 1..233 1..233 1227 98.7 Plus
Dere\GG24164-PA 210 GG24164-PA 3..198 6..233 464 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18517-PA 236 GH18517-PA 1..236 1..233 1058 82.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13827-PA 233 CG13827-PA 1..233 1..233 1202 100 Plus
CG13827-PB 234 CG13827-PB 24..234 23..233 1081 100 Plus
CG33474-PB 201 CG33474-PB 3..201 6..233 415 39 Plus
CG33474-PA 201 CG33474-PA 3..201 6..233 415 39 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24362-PA 236 GI24362-PA 1..236 1..233 1095 85.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24492-PA 233 GL24492-PA 1..233 1..233 1113 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12553-PA 233 GA12553-PA 1..233 1..233 1119 88.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26496-PA 233 GM26496-PA 1..233 1..233 1230 98.7 Plus
Dsec\GM21215-PA 201 GM21215-PA 3..201 6..233 465 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21009-PA 233 GD21009-PA 1..233 1..233 1223 97.9 Plus
Dsim\GD25984-PA 201 GD25984-PA 3..201 6..233 460 41.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24372-PA 236 GJ24372-PA 1..236 1..233 1080 84.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11520-PA 233 GK11520-PA 1..233 1..233 1118 87.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10363-PA 233 GE10363-PA 1..233 1..233 1221 97.9 Plus
Dyak\GE19358-PA 80 GE19358-PA 1..80 139..233 149 35.8 Plus