Clone RE30687 Report

Search the DGRC for RE30687

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:306
Well:87
Vector:pFlc-1
Associated Gene/TranscriptCG10904-RA
Protein status:RE30687.pep: gold
Preliminary Size:981
Sequenced Size:962

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10904 2001-12-14 Blastp of sequenced clone
CG10904 2002-01-01 Sim4 clustering to Release 2
CG10904 2003-01-01 Sim4 clustering to Release 3
CG10904 2008-04-29 Release 5.5 accounting
CG10904 2008-08-15 Release 5.9 accounting
CG10904 2008-12-18 5.12 accounting

Clone Sequence Records

RE30687.complete Sequence

962 bp (962 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071276

> RE30687.complete
ATCCCAAATGTGCACTGCAATAAGATTCGATGCATATTGACATATTGTTG
TTAGTTTGCTGAGATGCCAAATAAATCCGAGGAGCTGGGCGAAACGCAAC
TGACCAAAAGACAGAGGAGGAAGCAGACGATCTGGACGCGGGAGAAGATC
GCCAAGCTAATCGAACTTTACCGCTCGTCGGACTGCTTGTGGAACCACTA
TTCCGAGCTATATAAAAACAAGGATTGCAGGGCTAAAGCCATCGAATCCA
TCTGCGCTTCGCTTGAAATAACGAAACACGACTATGGCAAGAAGGTGCAC
AACCTGCGCAATCAATTCAATGCAGAGCTCAAGAAGTTGGAGAGGAGGCT
CGAGGAGTCTGGAGGAGATCGAGATTCGGAGAAGGCTTGTCGATGGGAGC
ACTTCAAGACGTTGATGTTCCTACGATCTGTTATAGAACCACGACCAGGC
TATCAACAAGGTGCTCCGGGCAAGAAATTGGTATCGAAGCTGGACATGTG
CTACCCGGATCAGGATGTGGAAAAGCAGAGCCAATCCTCGATAGAAAGTC
TGGAATCCATGATCATAGAGAACGATGCAGAAATCTGTCAGCCTCCGAAG
GTCAGCGAACCCATTCCTCCGATGCCTCCTGAACCTGCGCCGTCTTCCAA
ATTCGTTGATCCAAATCGAACTGTCGAAGCTCCAGCTGCTCCCTCTCCCT
TCCACTTACCATTAAGTGGTCGTGATCAATGGGACGCATTTGGCGAACTA
ATCGCCAGTGAATTCCGTAACCTGAACTCTGAAGTTTCGCGCAAGAGGCT
GAAGCGGAAAATAATGCAAGTTATGCTGGAAGTCGGCGAAGAAGATGATC
TTACAAACAGTTGATTGTAGAATTATGAACATGTTTAATACAGCGGACAC
CGTTTTAGGTATAAATCTTTAATATATGCAGCACACAGATCATGCCAAAA
AAAAAAAAAAAA

RE30687.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10904-RA 1246 CG10904-RA 172..1116 1..945 4725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19855143..19855615 945..473 2365 100 Minus
chr2R 21145070 chr2R 19855677..19856150 474..1 2340 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23969596..23970069 474..1 2370 100 Minus
2R 25286936 2R 23969062..23969534 945..473 2365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23970795..23971268 474..1 2370 100 Minus
2R 25260384 2R 23970261..23970733 945..473 2365 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:39:56 has no hits.

RE30687.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:40:41 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19855142..19855613 475..946 99 <- Minus
chr2R 19855677..19856150 1..474 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:45 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..801 64..864 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:13 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..801 64..864 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:45 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..801 64..864 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:29 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..801 64..864 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:31 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..801 64..864 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:04 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..945 1..946 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:13 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..945 1..946 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:45 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 5..949 1..946 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:29 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 1..945 1..946 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:31 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
CG10904-RA 5..949 1..946 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:41 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23969061..23969532 475..946 99 <- Minus
2R 23969596..23970069 1..474 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:41 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23969061..23969532 475..946 99 <- Minus
2R 23969596..23970069 1..474 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:41 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23969061..23969532 475..946 99 <- Minus
2R 23969596..23970069 1..474 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:45 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19856584..19857055 475..946 99 <- Minus
arm_2R 19857119..19857592 1..474 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:24 Download gff for RE30687.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23970278..23970749 475..946 99 <- Minus
2R 23970813..23971286 1..474 100   Minus

RE30687.hyp Sequence

Translation from 63 to 863

> RE30687.hyp
MPNKSEELGETQLTKRQRRKQTIWTREKIAKLIELYRSSDCLWNHYSELY
KNKDCRAKAIESICASLEITKHDYGKKVHNLRNQFNAELKKLERRLEESG
GDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYPDQ
DVEKQSQSSIESLESMIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDP
NRTVEAPAAPSPFHLPLSGRDQWDAFGELIASEFRNLNSEVSRKRLKRKI
MQVMLEVGEEDDLTNS*

RE30687.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10904-PB 266 CG10904-PB 1..266 1..266 1400 100 Plus
CG10904-PA 266 CG10904-PA 1..266 1..266 1400 100 Plus

RE30687.pep Sequence

Translation from 63 to 863

> RE30687.pep
MPNKSEELGETQLTKRQRRKQTIWTREKIAKLIELYRSSDCLWNHYSELY
KNKDCRAKAIESICASLEITKHDYGKKVHNLRNQFNAELKKLERRLEESG
GDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYPDQ
DVEKQSQSSIESLESMIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDP
NRTVEAPAAPSPFHLPLSGRDQWDAFGELIASEFRNLNSEVSRKRLKRKI
MQVMLEVGEEDDLTNS*

RE30687.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12047-PA 263 GF12047-PA 1..256 1..263 792 60.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19972-PA 265 GG19972-PA 1..265 1..266 1259 89.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20177-PA 266 GH20177-PA 6..259 10..262 683 54 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10904-PB 266 CG10904-PB 1..266 1..266 1400 100 Plus
CG10904-PA 266 CG10904-PA 1..266 1..266 1400 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20688-PA 265 GI20688-PA 13..258 16..262 707 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10439-PA 290 GL10439-PA 6..286 6..266 764 58.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10629-PA 290 GA10629-PA 6..286 6..266 757 57.6 Plus
Dpse\GA25556-PA 115 GA25556-PA 1..98 23..122 155 35 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15485-PA 265 GM15485-PA 1..265 1..266 1345 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24988-PA 265 GD24988-PA 1..265 1..266 1368 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19741-PA 270 GJ19741-PA 1..268 1..262 625 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15847-PA 277 GK15847-PA 3..269 7..262 751 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11504-PA 265 GE11504-PA 1..265 1..266 1153 90.2 Plus