Clone RE30690 Report

Search the DGRC for RE30690

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:306
Well:90
Vector:pFlc-1
Associated Gene/TranscriptRpL24-RA
Protein status:RE30690.pep: gold
Sequenced Size:815

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9282 2001-12-14 Blastp of sequenced clone
CG9282 2002-01-01 Sim4 clustering to Release 2
CG9282 2003-01-01 Sim4 clustering to Release 3
RpL24 2008-04-29 Release 5.5 accounting
RpL24 2008-08-15 Release 5.9 accounting
RpL24 2008-12-18 5.12 accounting

Clone Sequence Records

RE30690.complete Sequence

815 bp (815 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071277

> RE30690.complete
ACTTACGTTTTCTTTTCTTTTCGTGTTTCTACGCCAGCAAGATGAAAATT
GGCTTGTGCGCATTCAGCGGGTACAAAATCTACCCCGGTCATGGCAAGAC
CATGGTCAAGATCGATGGCAAGTCGTTCACCTTCCTGGACAAGAAGTGCG
AGCGCTCCTACCTGATGAAGCGCAATCCCCGCAAGGTTACGTGGACCGTG
CTGTACCGCCGGAAGCACCGCAAGGGAATCGAGGAGGAGGCCTCCAAGAA
GCGCACCCGCCGCACCCAGAAGTTCCAGCGCGCCATCGTCGGTGCCTCGC
TGGCCGAGATTCTGGCCAAGCGTAACATGAAGCCCGAGGTGCGCAAGGCG
CAGCGCGACCAGGCCATCAAGGTGGCCAAGGAGCAGAAGCGTGCCGTCAA
GGCCGCCAAGAAGGCTGCTGCCCCCGCTCCCGCTAAGAAGTCGGCGCCCA
AGCAGAAGGCCGCCAAGGTCACGCAGAAGGCTGCTCCCCGCGTCGGAGGC
AAGCGGTAAACACCTTTCGCCGGTAGTGATGTGCTAAAGTTAGTCCAGGA
TTTAAGGAACCACTCGTGAATTGAAAATTAAACAAACGCCGCGAATGCGA
ATTCGTGGTGACCAAAAAAAAAACTGTCGCGTGTTCTTTCTATCAAGCTT
GGCTTACAGTGTGGAAGCTACACAAGAAAGGAATATCATATTGTGTACGT
CATGAATCATCAACTTAACTTTAACCATCAGTTTTGACCAGATGACAGAG
TTTTAAATTGTCATGTTTATTAAAAGGCAAATATATACCTTCGAACCATA
AAAAAAAAAAAAAAA

RE30690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpL24-RA 1091 RpL24-RA 100..899 1..800 3985 99.8 Plus
RpL24.a 761 RpL24.a 28..450 1..423 2025 98.5 Plus
RpL24.a 761 RpL24.a 420..761 459..800 1695 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13392796..13393474 799..121 3395 100 Minus
chr2L 23010047 chr2L 13393538..13393613 122..47 380 100 Minus
chr2L 23010047 chr2L 13393729..13393774 46..1 215 97.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13394122..13394801 800..121 3400 100 Minus
2L 23513712 2L 13394865..13394940 122..47 380 100 Minus
2L 23513712 2L 13395056..13395101 46..1 215 97.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13394122..13394801 800..121 3400 100 Minus
2L 23513712 2L 13394865..13394940 122..47 380 100 Minus
2L 23513712 2L 13395056..13395101 46..1 215 97.8 Minus
Blast to na_te.dros performed on 2019-03-16 21:08:00 has no hits.

RE30690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:09:02 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13392796..13393472 123..799 100 <- Minus
chr2L 13393538..13393613 47..122 100 <- Minus
chr2L 13393729..13393774 1..46 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:46 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..468 42..509 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:04 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..468 42..509 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:29 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..468 42..509 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:21 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..468 42..509 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:07 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..468 42..509 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:52 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 15..813 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:04 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 15..813 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:29 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 1..790 10..799 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:21 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RA 15..813 1..799 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:07 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-RC 31..829 1..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:02 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13394123..13394799 123..799 100 <- Minus
2L 13394865..13394940 47..122 100 <- Minus
2L 13395056..13395101 1..46 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:02 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13394123..13394799 123..799 100 <- Minus
2L 13394865..13394940 47..122 100 <- Minus
2L 13395056..13395101 1..46 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:02 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13394123..13394799 123..799 100 <- Minus
2L 13394865..13394940 47..122 100 <- Minus
2L 13395056..13395101 1..46 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:29 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13394123..13394799 123..799 100 <- Minus
arm_2L 13394865..13394940 47..122 100 <- Minus
arm_2L 13395056..13395101 1..46 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:13 Download gff for RE30690.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13394123..13394799 123..799 100 <- Minus
2L 13394865..13394940 47..122 100 <- Minus
2L 13395056..13395101 1..46 97   Minus

RE30690.hyp Sequence

Translation from 2 to 508

> RE30690.hyp
FRFLFFSCFYASKMKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCE
RSYLMKRNPRKVTWTVLYRRKHRKGIEEEASKKRTRRTQKFQRAIVGASL
AEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKAAAPAPAKKSAPK
QKAAKVTQKAAPRVGGKR*

RE30690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
RpL24-PC 155 CG9282-PC 1..155 14..168 785 100 Plus
RpL24-PB 155 CG9282-PB 1..155 14..168 785 100 Plus
RpL24-PA 155 CG9282-PA 1..155 14..168 785 100 Plus
RpL24-like-PA 191 CG6764-PA 1..151 14..155 172 30.5 Plus

RE30690.pep Sequence

Translation from 41 to 508

> RE30690.pep
MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVT
WTVLYRRKHRKGIEEEASKKRTRRTQKFQRAIVGASLAEILAKRNMKPEV
RKAQRDQAIKVAKEQKRAVKAAKKAAAPAPAKKSAPKQKAAKVTQKAAPR
VGGKR*

RE30690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21662-PA 155 GF21662-PA 1..155 1..155 621 95.5 Plus
Dana\GF18157-PA 191 GF18157-PA 1..57 1..57 146 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10203-PA 154 GG10203-PA 1..154 2..155 778 98.7 Plus
Dere\GG17222-PA 191 GG17222-PA 1..57 1..57 146 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11098-PA 155 GH11098-PA 1..155 1..155 777 97.4 Plus
Dgri\GH23979-PA 191 GH23979-PA 1..57 1..57 143 47.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpL24-PC 155 CG9282-PC 1..155 1..155 785 100 Plus
RpL24-PB 155 CG9282-PB 1..155 1..155 785 100 Plus
RpL24-PA 155 CG9282-PA 1..155 1..155 785 100 Plus
RpL24-like-PA 191 CG6764-PA 1..151 1..142 172 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18222-PA 155 GI18222-PA 1..155 1..155 772 96.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25708-PA 155 GL25708-PA 1..155 1..155 645 92.9 Plus
Dper\GL12604-PA 192 GL12604-PA 1..57 1..57 146 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22528-PA 155 GA22528-PA 1..155 1..155 777 97.4 Plus
Dpse\GA21667-PA 155 GA21667-PA 1..155 1..155 777 97.4 Plus
Dpse\GA19846-PA 192 GA19846-PA 1..57 1..57 146 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25565-PA 155 GM25565-PA 1..155 1..155 790 100 Plus
Dsec\GM26099-PA 191 GM26099-PA 1..57 1..57 149 49.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22063-PA 155 GD22063-PA 1..155 1..155 790 100 Plus
Dsim\GD20660-PA 191 GD20660-PA 1..57 1..57 149 49.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18129-PA 155 GJ18129-PA 1..155 1..155 778 97.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15282-PA 155 GK15282-PA 1..155 1..155 770 96.1 Plus
Dwil\GK11794-PA 191 GK11794-PA 1..57 1..57 144 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11634-PA 135 GE11634-PA 1..135 21..155 672 100 Plus
Dyak\GE24623-PA 191 GE24623-PA 1..57 1..57 146 47.4 Plus