Clone RE31024 Report

Search the DGRC for RE31024

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:310
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCG3192-RA
Protein status:RE31024.pep: gold
Sequenced Size:703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3192-RA 2009-01-21 est gleaning
CG3192 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RE31024.complete Sequence

703 bp assembled on 2009-08-28

GenBank Submission: BT099663.1

> RE31024.complete
TGTTTTTTCGGGAATCGTAACTTCAGAGGAACTTTTTTTTAGTGGAAACA
AGCCTGCAATGTCGGCGTTTGTGAAAACCGTGTGCTTGGCCCAAAAGCTG
TGCGCCGCCAATCCCGTCGTGGCTCGCCAGGCGATCCGCAGCATGGCTGG
CTGGAATAAGGACTACAAGCCGGGTCCGTATCCACAGACGGAGAAGGAGC
GCCTGGCGGCGGCCAAGAAGTACTATCTGTTGCCGGAGGAGTACAAACCG
TATGCGGACGATGGTCTGGGCTACGGAGATTATCCCAAATTGGGCTACGG
TCTGGGTGTGGAGGCCAAGGACTCGTACTATCCCTGGGACTATCCGGAGC
ACAAGCGCAACCAACACGAGCCCATCTCGGCGGATCATGATCTGTACAGC
GAGGATCGCTGGTCGCAGGCCGAACCGCCACGCTACAGCAATGCGTACTA
CTTTGCCTGCTTCCTGGGCGTGATGTCCGGCTGCCTGGCACTCTACTACT
GGCTGGATGACAAGAAGATGTACCGCCCCGTGGCCGCCAAGCAATATCCC
AGCCCTGGCGTCAAGCACTACACCTTCGAGAAGTAGGATTGTATCTATCA
CGCTCTCGATCGCACTGCGCGCCTCGTTTTTATTTCATAGGCAATTAATC
AACGCATCTATACAATTAAAATGAATGGAAACCAAGCAAAAAAAAAAAAA
AAA

RE31024.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG3192-RA 1333 CG3192-RA 635..1326 1..692 3445 99.8 Plus
CG3192-RB 967 CG3192-RB 208..899 1..692 3445 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6569434..6569747 687..374 1570 100 Minus
chrX 22417052 chrX 6569824..6570053 373..144 1120 99.1 Minus
chrX 22417052 chrX 6570172..6570314 143..1 685 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6677257..6677575 692..374 1580 99.7 Minus
X 23542271 X 6677652..6677881 373..144 1150 100 Minus
X 23542271 X 6678000..6678142 143..1 715 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6685355..6685673 692..374 1580 99.6 Minus
X 23527363 X 6685750..6685979 373..144 1150 100 Minus
X 23527363 X 6686098..6686240 143..1 715 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:08:01 has no hits.

RE31024.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:45 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6569434..6569747 374..687 100 <- Minus
chrX 6569824..6570053 144..373 99 <- Minus
chrX 6570172..6570314 1..143 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:03 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RB 1..528 59..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:00 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RB 1..528 59..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:04:13 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 1..528 59..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:26 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 1..528 59..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-28 12:06:12 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RB 119..805 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:00 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RB 119..805 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:04:13 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 635..1321 1..687 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:26 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 635..1321 1..687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:45 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
X 6677652..6677881 144..373 100 <- Minus
X 6678000..6678142 1..143 100   Minus
X 6677262..6677575 374..687 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:45 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
X 6677652..6677881 144..373 100 <- Minus
X 6678000..6678142 1..143 100   Minus
X 6677262..6677575 374..687 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:45 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
X 6677652..6677881 144..373 100 <- Minus
X 6678000..6678142 1..143 100   Minus
X 6677262..6677575 374..687 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:04:13 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6571295..6571608 374..687 100 <- Minus
arm_X 6571685..6571914 144..373 100 <- Minus
arm_X 6572033..6572175 1..143 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:08 Download gff for RE31024.complete
Subject Subject Range Query Range Percent Splice Strand
X 6685360..6685673 374..687 100 <- Minus
X 6685750..6685979 144..373 100 <- Minus
X 6686098..6686240 1..143 100   Minus

RE31024.hyp Sequence

Translation from 0 to 585

> RE31024.hyp
VFSGIVTSEELFFSGNKPAMSAFVKTVCLAQKLCAANPVVARQAIRSMAG
WNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYG
LGVEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPPRYSNAYY
FACFLGVMSGCLALYYWLDDKKMYRPVAAKQYPSPGVKHYTFEK*

RE31024.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3192-PC 175 CG3192-PC 1..175 20..194 978 100 Plus
CG3192-PB 175 CG3192-PB 1..175 20..194 978 100 Plus
CG3192-PA 175 CG3192-PA 1..175 20..194 978 100 Plus

RE31024.pep Sequence

Translation from 1 to 585

> RE31024.pep
VFSGIVTSEELFFSGNKPAMSAFVKTVCLAQKLCAANPVVARQAIRSMAG
WNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYG
LGVEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPPRYSNAYY
FACFLGVMSGCLALYYWLDDKKMYRPVAAKQYPSPGVKHYTFEK*

RE31024.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20848-PA 177 GF20848-PA 1..175 20..194 850 88.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17665-PA 175 GG17665-PA 1..175 20..194 889 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24238-PA 175 GH24238-PA 1..175 20..194 715 74.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
ND-ASHI-PC 175 CG3192-PC 1..175 20..194 978 100 Plus
ND-ASHI-PB 175 CG3192-PB 1..175 20..194 978 100 Plus
ND-ASHI-PA 175 CG3192-PA 1..175 20..194 978 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21434-PA 175 GI21434-PA 1..175 20..194 711 76 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13370-PA 175 GL13370-PA 1..175 20..194 776 82.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16565-PA 175 GA16565-PA 1..175 20..194 776 82.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12565-PA 175 GM12565-PA 1..175 20..194 904 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16186-PA 175 GD16186-PA 1..175 20..194 916 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16452-PA 175 GJ16452-PA 1..175 20..194 741 77.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17672-PA 175 GK17672-PA 1..175 20..194 764 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16455-PA 175 GE16455-PA 1..175 20..194 895 96.6 Plus