Clone RE31184 Report

Search the DGRC for RE31184

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:311
Well:84
Vector:pFlc-1
Associated Gene/TranscriptmRpS26-RA
Protein status:RE31184.pep: gold
Preliminary Size:741
Sequenced Size:839

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7354 2001-12-14 Blastp of sequenced clone
CG7354 2002-01-01 Sim4 clustering to Release 2
CG7354 2003-01-01 Sim4 clustering to Release 3
mRpS26 2008-04-29 Release 5.5 accounting
mRpS26 2008-08-15 Release 5.9 accounting
mRpS26 2008-12-18 5.12 accounting

Clone Sequence Records

RE31184.complete Sequence

839 bp (839 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071284

> RE31184.complete
AGTTCACCGACAACAGAGTTGCACAACAGTTCAGCAGCGGCAAAGTAAAA
ATTACATTTTGTTAATTAAACTGCTTTTATAATGCTGCGAGCGGGATGCC
AGCTGCTGACGCAGTCCACCCTGCCCACCGGGAAGACGGTCGGAAATAGT
TTCGCCCTCGAGTTCGTCCGCTGGCGCAGGAAACCGCGATGGCTGCCGGT
GGCCAAGAGCAAGATGTTCCGCGTGCCTGAACGCAAGAAGCAGTCGGAGG
AGGAGCGCACGGAGCTCATGAGGCTACACAACCAGTACAAAACGCAGCTT
CGCTCAGTGCGTCAGTTTCTAAGGGAGGAAGTCGTCCGCCACGAGGAAAC
ATCCACAGCAGATCACATCGTGCTCACTCCCGAGCAGGAGGAGGCCGAGT
TCCAGAAATGCCTGGATGCCAATGCTGCCTGGAACGCTGCCATAGCCAAG
GAGCGTGATCAGCGATTGGCCAAGAAGCGTGAGGAAAAGGTGGCCTATAT
TCAGGAGCGATTGGAGGCACAACAGCTGCGCGAGGAGGAGCGCAAGGAGC
AGGCCAACCAGCGGGTGCTGCTCGAGATTGAGCGTTCCAAGAACTATATC
ACTAGGGAAAACTTGGATGCAGCCATTGAGACAGCGTTGGCCAATCCCGT
GGACCACAATTTCGCCATCGATATGGCCGGTAATCTTTACCACGGACGAA
GCACCTCTCAGCTCCCGGACGCCACTCCCGAACCCAACCAGCAAGTTTTG
AGTAATTAATTAATGCAGTGTCTTAGTTTGTTGTTACATTAAAATGCTTT
TTATAGGTTTCTAACCAAAGTTGAAAAAAAAAAAAAAAA

RE31184.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS26-RA 1181 mRpS26-RA 116..941 1..826 4130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18096653..18097185 291..823 2665 100 Plus
chr3L 24539361 chr3L 18096267..18096556 1..290 1450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18106967..18107502 291..826 2680 100 Plus
3L 28110227 3L 18106581..18106870 1..290 1450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18100067..18100602 291..826 2680 100 Plus
3L 28103327 3L 18099681..18099970 1..290 1450 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:40:53 has no hits.

RE31184.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:42:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18096267..18096556 1..290 100 -> Plus
chr3L 18096653..18097185 291..823 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:08 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..678 82..759 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:34 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..678 82..759 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..678 82..759 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:48 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..678 82..759 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:49 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..678 82..759 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:11 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..823 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:34 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..823 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 3..825 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:48 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 1..823 1..823 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:49 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS26-RA 3..825 1..823 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18106581..18106870 1..290 100 -> Plus
3L 18106967..18107499 291..823 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18106581..18106870 1..290 100 -> Plus
3L 18106967..18107499 291..823 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18106581..18106870 1..290 100 -> Plus
3L 18106967..18107499 291..823 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:05 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18100067..18100599 291..823 100   Plus
arm_3L 18099681..18099970 1..290 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:54 Download gff for RE31184.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18099681..18099970 1..290 100 -> Plus
3L 18100067..18100599 291..823 100   Plus

RE31184.hyp Sequence

Translation from 81 to 758

> RE31184.hyp
MLRAGCQLLTQSTLPTGKTVGNSFALEFVRWRRKPRWLPVAKSKMFRVPE
RKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVLTP
EQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLR
EEERKEQANQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAG
NLYHGRSTSQLPDATPEPNQQVLSN*

RE31184.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS26-PA 225 CG7354-PA 1..225 1..225 1149 100 Plus

RE31184.pep Sequence

Translation from 81 to 758

> RE31184.pep
MLRAGCQLLTQSTLPTGKTVGNSFALEFVRWRRKPRWLPVAKSKMFRVPE
RKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVLTP
EQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLR
EEERKEQANQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAG
NLYHGRSTSQLPDATPEPNQQVLSN*

RE31184.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24580-PA 225 GF24580-PA 1..225 1..225 960 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13648-PA 225 GG13648-PA 1..225 1..225 986 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14447-PA 204 GH14447-PA 1..204 1..206 839 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS26-PA 225 CG7354-PA 1..225 1..225 1149 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13582-PA 212 GI13582-PA 1..207 1..208 837 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22860-PA 225 GL22860-PA 1..225 1..225 975 81.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20288-PA 225 GA20288-PA 1..225 1..225 976 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14962-PA 225 GM14962-PA 1..225 1..225 1138 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13920-PA 213 GJ13920-PA 1..211 1..211 870 77.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11078-PA 224 GK11078-PA 1..222 1..223 936 79.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19942-PA 225 GE19942-PA 1..225 1..225 1116 93.3 Plus