BDGP Sequence Production Resources |
Search the DGRC for RE31184
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 311 |
Well: | 84 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS26-RA |
Protein status: | RE31184.pep: gold |
Preliminary Size: | 741 |
Sequenced Size: | 839 |
Gene | Date | Evidence |
---|---|---|
CG7354 | 2001-12-14 | Blastp of sequenced clone |
CG7354 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7354 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS26 | 2008-04-29 | Release 5.5 accounting |
mRpS26 | 2008-08-15 | Release 5.9 accounting |
mRpS26 | 2008-12-18 | 5.12 accounting |
839 bp (839 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071284
> RE31184.complete AGTTCACCGACAACAGAGTTGCACAACAGTTCAGCAGCGGCAAAGTAAAA ATTACATTTTGTTAATTAAACTGCTTTTATAATGCTGCGAGCGGGATGCC AGCTGCTGACGCAGTCCACCCTGCCCACCGGGAAGACGGTCGGAAATAGT TTCGCCCTCGAGTTCGTCCGCTGGCGCAGGAAACCGCGATGGCTGCCGGT GGCCAAGAGCAAGATGTTCCGCGTGCCTGAACGCAAGAAGCAGTCGGAGG AGGAGCGCACGGAGCTCATGAGGCTACACAACCAGTACAAAACGCAGCTT CGCTCAGTGCGTCAGTTTCTAAGGGAGGAAGTCGTCCGCCACGAGGAAAC ATCCACAGCAGATCACATCGTGCTCACTCCCGAGCAGGAGGAGGCCGAGT TCCAGAAATGCCTGGATGCCAATGCTGCCTGGAACGCTGCCATAGCCAAG GAGCGTGATCAGCGATTGGCCAAGAAGCGTGAGGAAAAGGTGGCCTATAT TCAGGAGCGATTGGAGGCACAACAGCTGCGCGAGGAGGAGCGCAAGGAGC AGGCCAACCAGCGGGTGCTGCTCGAGATTGAGCGTTCCAAGAACTATATC ACTAGGGAAAACTTGGATGCAGCCATTGAGACAGCGTTGGCCAATCCCGT GGACCACAATTTCGCCATCGATATGGCCGGTAATCTTTACCACGGACGAA GCACCTCTCAGCTCCCGGACGCCACTCCCGAACCCAACCAGCAAGTTTTG AGTAATTAATTAATGCAGTGTCTTAGTTTGTTGTTACATTAAAATGCTTT TTATAGGTTTCTAACCAAAGTTGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS26-RA | 1181 | mRpS26-RA | 116..941 | 1..826 | 4130 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18096267..18096556 | 1..290 | 100 | -> | Plus |
chr3L | 18096653..18097185 | 291..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..678 | 82..759 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..678 | 82..759 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..678 | 82..759 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..678 | 82..759 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..678 | 82..759 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..823 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..823 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 3..825 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 1..823 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS26-RA | 3..825 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18106581..18106870 | 1..290 | 100 | -> | Plus |
3L | 18106967..18107499 | 291..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18106581..18106870 | 1..290 | 100 | -> | Plus |
3L | 18106967..18107499 | 291..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18106581..18106870 | 1..290 | 100 | -> | Plus |
3L | 18106967..18107499 | 291..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18100067..18100599 | 291..823 | 100 | Plus | |
arm_3L | 18099681..18099970 | 1..290 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18099681..18099970 | 1..290 | 100 | -> | Plus |
3L | 18100067..18100599 | 291..823 | 100 | Plus |
Translation from 81 to 758
> RE31184.hyp MLRAGCQLLTQSTLPTGKTVGNSFALEFVRWRRKPRWLPVAKSKMFRVPE RKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVLTP EQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLR EEERKEQANQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAG NLYHGRSTSQLPDATPEPNQQVLSN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS26-PA | 225 | CG7354-PA | 1..225 | 1..225 | 1149 | 100 | Plus |
Translation from 81 to 758
> RE31184.pep MLRAGCQLLTQSTLPTGKTVGNSFALEFVRWRRKPRWLPVAKSKMFRVPE RKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVLTP EQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLR EEERKEQANQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAG NLYHGRSTSQLPDATPEPNQQVLSN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24580-PA | 225 | GF24580-PA | 1..225 | 1..225 | 960 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13648-PA | 225 | GG13648-PA | 1..225 | 1..225 | 986 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14447-PA | 204 | GH14447-PA | 1..204 | 1..206 | 839 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS26-PA | 225 | CG7354-PA | 1..225 | 1..225 | 1149 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13582-PA | 212 | GI13582-PA | 1..207 | 1..208 | 837 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22860-PA | 225 | GL22860-PA | 1..225 | 1..225 | 975 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20288-PA | 225 | GA20288-PA | 1..225 | 1..225 | 976 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14962-PA | 225 | GM14962-PA | 1..225 | 1..225 | 1138 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13920-PA | 213 | GJ13920-PA | 1..211 | 1..211 | 870 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11078-PA | 224 | GK11078-PA | 1..222 | 1..223 | 936 | 79.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19942-PA | 225 | GE19942-PA | 1..225 | 1..225 | 1116 | 93.3 | Plus |