Clone RE31192 Report

Search the DGRC for RE31192

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:311
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG30269-RA
Protein status:RE31192.pep: gold
Sequenced Size:589

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30269-RA 2009-01-21 est gleaning
CG30269 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RE31192.complete Sequence

589 bp assembled on 2009-08-05

GenBank Submission: BT089039.1

> RE31192.complete
GAGTCATTTTCCAGCGATTCACACACCCAGTTGGGCCAAAATATCATGGA
TTCCGTCTATCCAGCTGCACCCTTGGAGGCGCCCAAGGGATCCGTCGAGC
TGCAGGCGACACCCGAGCAACAACACCTTCTGCCACCGGCTCCACCCAGT
TACGACCAGGCCACAACCACTCCGGCTGAAACCACGGGACCAGCTCCAGT
TCCAGCGAGCACATCCACCACACAGCACACGGTCGTCGTGGTGCCCGGTT
CACCGTACGGCCCGGAGCCCATGGACGTGCAGTGCCCGTACTGCCACAAT
TACGCCCGGACACGGGTCTCCTTCAAGCCCAACTCGCGCACCCATCTGAT
AGCCTTGATATTATGCCTGTTCCAGTTGTACTGCTGTGTGTGTCTGCCGT
ACTGCATTTCCAGTTGCATGAACACCAATCACTACTGTGGCATGTGCGAT
CGTTATTTGGGCACCTACGATCGCAAATGAGCAACCAAAAATGTTTCGGG
GGCGACCTGTTCATGTGTACATATTTTCTTCAAGTAATTAGTTAATAAAT
GGACTGCAGCACGCAAACTGAACAAAAAAAAAAAAAAAA

RE31192.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30269-RA 539 CG30269-RA 1..539 1..539 2695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18554477..18554852 1..376 1790 98.4 Plus
chr2R 21145070 chr2R 18555186..18555384 375..573 995 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22667942..22668317 1..376 1880 100 Plus
2R 25286936 2R 22668649..22668851 375..577 1000 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22669141..22669516 1..376 1880 100 Plus
2R 25260384 2R 22669848..22670050 375..577 1000 99.5 Plus
Blast to na_te.dros performed 2019-03-16 14:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 4316..4344 53..25 109 86.2 Minus

RE31192.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:39 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18555186..18555384 375..573 100   Plus
chr2R 18554477..18554850 1..374 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:48 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..435 46..480 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:54:47 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..435 46..480 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:31:05 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..435 46..480 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:45 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..435 46..480 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-05 16:24:38 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..539 1..539 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:54:47 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 1..573 1..573 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:31:05 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 4..576 1..573 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:45 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 4..576 1..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:39 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22667942..22668315 1..374 100 -> Plus
2R 22668649..22668847 375..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:39 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22667942..22668315 1..374 100 -> Plus
2R 22668649..22668847 375..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:39 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22667942..22668315 1..374 100 -> Plus
2R 22668649..22668847 375..573 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:31:05 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18556154..18556352 375..573 100   Plus
arm_2R 18555447..18555820 1..374 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:46:28 Download gff for RE31192.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22669141..22669514 1..374 100 -> Plus
2R 22669848..22670046 375..573 100   Plus

RE31192.hyp Sequence

Translation from 0 to 479

> RE31192.hyp
ESFSSDSHTQLGQNIMDSVYPAAPLEAPKGSVELQATPEQQHLLPPAPPS
YDQATTTPAETTGPAPVPASTSTTQHTVVVVPGSPYGPEPMDVQCPYCHN
YARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCD
RYLGTYDRK*

RE31192.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG30269-PB 144 CG30269-PB 1..144 16..159 805 100 Plus
CG30269-PA 144 CG30269-PA 1..144 16..159 805 100 Plus
CG30273-PB 128 CG30273-PB 11..126 38..157 286 42.9 Plus
CG13510-PC 129 CG13510-PC 7..128 48..157 254 41.8 Plus
CG13510-PB 129 CG13510-PB 7..128 48..157 254 41.8 Plus

RE31192.pep Sequence

Translation from 0 to 479

> RE31192.pep
ESFSSDSHTQLGQNIMDSVYPAAPLEAPKGSVELQATPEQQHLLPPAPPS
YDQATTTPAETTGPAPVPASTSTTQHTVVVVPGSPYGPEPMDVQCPYCHN
YARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCD
RYLGTYDRK*

RE31192.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11636-PA 142 GF11636-PA 1..142 16..159 575 83.4 Plus
Dana\GF11635-PA 127 GF11635-PA 53..125 85..157 221 47.9 Plus
Dana\GF11638-PA 164 GF11638-PA 38..161 47..159 211 42.7 Plus
Dana\GF11281-PA 129 GF11281-PA 56..129 85..158 209 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22780-PA 150 GG22780-PA 1..150 16..159 625 84.7 Plus
Dere\GG22779-PA 128 GG22779-PA 20..126 48..157 252 43.2 Plus
Dere\GG21061-PA 129 GG21061-PA 7..129 48..158 214 40.7 Plus
Dere\GG21064-PA 113 GG21064-PA 13..113 46..158 190 35.4 Plus
Dere\GG21063-PA 77 GG21063-PA 2..77 83..158 173 46.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19769-PA 142 GH19769-PA 1..142 16..159 481 74 Plus
Dgri\GH19768-PA 137 GH19768-PA 17..135 31..157 244 40.9 Plus
Dgri\GH19762-PA 102 GH19762-PA 6..101 57..157 217 49 Plus
Dgri\GH19761-PA 135 GH19761-PA 62..135 85..158 207 52.7 Plus
Dgri\GH19766-PA 130 GH19766-PA 14..130 47..158 179 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30269-PB 144 CG30269-PB 1..144 16..159 805 100 Plus
CG30269-PA 144 CG30269-PA 1..144 16..159 805 100 Plus
CG30273-PB 128 CG30273-PB 11..126 38..157 286 42.9 Plus
CG13510-PC 129 CG13510-PC 7..128 48..157 254 41.8 Plus
CG13510-PB 129 CG13510-PB 7..128 48..157 254 41.8 Plus
CG13510-PA 129 CG13510-PA 7..128 48..157 254 41.8 Plus
CG13516-PB 168 CG13516-PB 17..164 21..159 225 35.8 Plus
CG13516-PA 168 CG13516-PA 17..164 21..159 225 35.8 Plus
CG4250-PA 121 CG4250-PA 19..119 47..156 218 37.3 Plus
CG4250-PB 134 CG4250-PB 19..132 47..156 209 36 Plus
CG42566-PA 77 CG42566-PA 6..77 87..158 201 48.6 Plus
CG42566-PB 77 CG42566-PB 6..77 87..158 201 48.6 Plus
CG12645-PB 206 CG12645-PB 103..193 67..156 188 39.6 Plus
CG12645-PC 202 CG12645-PC 111..189 79..156 186 43 Plus
CG32280-PD 130 CG32280-PD 7..130 36..158 171 32 Plus
CG32280-PC 130 CG32280-PC 7..130 36..158 171 32 Plus
CG32280-PB 130 CG32280-PB 7..130 36..158 171 32 Plus
CG32280-PA 130 CG32280-PA 7..130 36..158 171 32 Plus
CG42565-PB 135 CG42565-PB 21..135 45..156 170 34.2 Plus
CG42565-PA 135 CG42565-PA 21..135 45..156 170 34.2 Plus
CG13511-PB 122 CG13511-PB 7..120 63..156 155 34.2 Plus
CG13511-PA 122 CG13511-PA 7..120 63..156 155 34.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20308-PA 152 GI20308-PA 1..152 16..159 468 66.2 Plus
Dmoj\GI20307-PA 126 GI20307-PA 25..124 48..157 222 40.2 Plus
Dmoj\GI20298-PA 135 GI20298-PA 20..135 37..158 210 40.2 Plus
Dmoj\GI20304-PA 121 GI20304-PA 5..117 44..154 207 42.5 Plus
Dmoj\GI20300-PA 165 GI20300-PA 77..162 68..155 201 42 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11367-PA 143 GL11367-PA 1..143 16..159 540 74.5 Plus
Dper\GL11366-PA 129 GL11366-PA 17..127 46..157 247 42.6 Plus
Dper\GL11361-PA 129 GL11361-PA 7..129 48..158 206 38.8 Plus
Dper\GL11368-PA 167 GL11368-PA 40..162 47..157 187 39.8 Plus
Dper\GL11364-PA 77 GL11364-PA 2..77 83..158 185 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15738-PA 143 GA15738-PA 1..143 16..159 540 74.5 Plus
Dpse\GA15742-PA 129 GA15742-PA 17..127 46..157 247 42.6 Plus
Dpse\GA12335-PA 129 GA12335-PA 7..129 48..158 206 38.8 Plus
Dpse\GA24699-PA 167 GA24699-PA 40..162 47..157 187 39.8 Plus
Dpse\GA24696-PA 77 GA24696-PA 2..77 83..158 185 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15937-PA 144 GM15937-PA 1..144 16..159 708 92.4 Plus
Dsec\GM15936-PA 156 GM15936-PA 43..154 42..157 251 41.5 Plus
Dsec\GM15931-PA 129 GM15931-PA 7..129 48..158 211 40.7 Plus
Dsec\GM15934-PA 147 GM15934-PA 76..147 87..158 182 47.2 Plus
Dsec\GM15939-PA 168 GM15939-PA 81..164 77..159 173 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11691-PA 144 GD11691-PA 1..144 16..159 721 94.4 Plus
Dsim\GD11689-PA 128 GD11689-PA 9..126 36..157 252 40.3 Plus
Dsim\GD11684-PA 129 GD11684-PA 7..129 48..158 211 40.7 Plus
Dsim\GD11688-PA 121 GD11688-PA 19..121 47..158 188 37.7 Plus
Dsim\GD11687-PA 77 GD11687-PA 6..77 87..158 178 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22034-PA 147 GJ22034-PA 1..147 16..159 520 73.3 Plus
Dvir\GJ22033-PA 113 GJ22033-PA 10..111 46..157 240 42.9 Plus
Dvir\GJ22036-PA 169 GJ22036-PA 12..166 16..159 197 36.6 Plus
Dvir\GJ22026-PA 137 GJ22026-PA 64..137 85..158 192 47.3 Plus
Dvir\GJ22027-PA 152 GJ22027-PA 79..149 85..155 183 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21445-PA 148 GK21445-PA 1..148 16..159 445 71.1 Plus
Dwil\GK21444-PA 121 GK21444-PA 5..119 35..157 234 39.8 Plus
Dwil\GK21440-PA 130 GK21440-PA 7..130 48..158 207 40.3 Plus
Dwil\GK21443-PA 150 GK21443-PA 12..150 39..158 181 32.4 Plus
Dwil\GK19389-PA 126 GK19389-PA 52..123 86..157 176 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14009-PA 148 GE14009-PA 1..148 16..159 675 87.8 Plus
Dyak\GE14008-PA 128 GE14008-PA 20..126 48..157 252 43.5 Plus
Dyak\GE14003-PA 128 GE14003-PA 6..128 48..158 211 40.7 Plus
Dyak\GE14007-PA 115 GE14007-PA 14..115 47..158 192 34.8 Plus
Dyak\GE14006-PA 77 GE14006-PA 2..77 83..158 190 48.7 Plus