Clone RE31218 Report

Search the DGRC for RE31218

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:312
Well:18
Vector:pFlc-1
Associated Gene/TranscriptCpr65Av-RA
Protein status:RE31218.pep: gold
Sequenced Size:657

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32405 2002-09-02 Blastp of sequenced clone
Cpr65Av 2008-04-29 Release 5.5 accounting
Cpr65Av 2008-08-15 Release 5.9 accounting
Cpr65Av 2008-12-18 5.12 accounting

Clone Sequence Records

RE31218.complete Sequence

657 bp (657 high quality bases) assembled on 2002-09-02

GenBank Submission: BT001606

> RE31218.complete
AGTCACATTACTCGTTAGTGCCTAATTGTGATAACTACCGGAGCGTGCAC
TAAAAACCAAACTTAGCCAGGACCTTTTGAAAAGTCTCTACCAGAATCCA
ATCCAACTAAACATGCAGTCCTCCAGCATCTGTGTCCTGGCCATTTGCGC
CTTCGCTCTGCTCTCCACCATTAGGGCTGCTCCTCTGGACGACTCCCAAC
ATGCCACCATACTAAGATACGACAACGACAACATTGGCACTGATGGCTAC
AACTTCGGCTACGAGACCAGTGATGGAGTTACCCGCCAGGAGCAGGCTGA
GGTGAAGAACGCCGGTACCGACCAGGAGGCGCTCAGTGTGCGCGGTTCCG
TCAGCTGGGTTGCTCCCGATGGCCAGACCTACACCCTGCACTACATTGCG
GATGAGAACGGTTTCCAGCCCCAGGGCGATCATCTGCCCCACAACTAAGT
ATTTCCTCTTTGTGTAGTCAGTATCGAAAGCAGTATTTCTTTATATTGTA
AAAATATCAGGGTTCTAAAGTATTTTAATGTTTGCTCCAATGATCATATT
TCATTATAATAACATAGTCGATATCAATACATAAATAGCTGAATCGTATT
GTTTGATTATTAAATTATCACAATCAAATGCCAGTCTTCAGAAAAAAAAA
AAAAAAA

RE31218.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av.a 1255 Cpr65Av.a 4..641 4..641 3190 100 Plus
Cpr65Av.b 1432 Cpr65Av.b 4..641 4..641 3190 100 Plus
Cpr65Av-RA 973 Cpr65Av-RA 311..948 4..641 3190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6131772..6132159 641..254 1910 99.5 Minus
chr3L 24539361 chr3L 6132258..6132512 258..4 1245 99.2 Minus
chr3L 24539361 chr3L 6140130..6140279 439..290 225 76.7 Minus
chr3L 24539361 chr3L 6143001..6143150 439..290 225 76.7 Minus
chr3L 24539361 chr3L 6137687..6137838 288..439 205 75.7 Plus
chr3L 24539361 chr3L 6144838..6144930 439..347 195 80.6 Minus
chr3L 24539361 chr3L 6125729..6125800 439..368 180 83.3 Minus
chr3L 24539361 chr3L 6127408..6127479 439..368 180 83.3 Minus
chr2R 21145070 chr2R 8291543..8291581 401..439 180 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6139223..6139610 641..254 1925 99.7 Minus
3L 28110227 3L 6139716..6139970 258..4 1275 100 Minus
3L 28110227 3L 6147581..6147730 439..290 225 76.7 Minus
3L 28110227 3L 6150452..6150601 439..290 225 76.7 Minus
3L 28110227 3L 6145138..6145289 288..439 205 75.7 Plus
3L 28110227 3L 6152287..6152379 439..347 195 80.6 Minus
3L 28110227 3L 6133172..6133243 439..368 180 83.3 Minus
3L 28110227 3L 6134853..6134924 439..368 180 83.3 Minus
2R 25286936 2R 12404317..12404355 401..439 180 97.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6132323..6132710 641..254 1925 99.7 Minus
3L 28103327 3L 6132816..6133070 258..4 1275 100 Minus
3L 28103327 3L 6143552..6143648 439..343 215 81.4 Minus
3L 28103327 3L 6140681..6140777 439..343 215 81.4 Minus
3L 28103327 3L 6145387..6145479 439..347 195 80.6 Minus
3L 28103327 3L 6127953..6128002 439..390 160 88 Minus
3L 28103327 3L 6126272..6126321 439..390 160 88 Minus
3L 28103327 3L 6130831..6130880 439..390 145 86 Minus
Blast to na_te.dros performed on 2019-03-15 20:14:05 has no hits.

RE31218.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:14:45 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6131772..6132154 259..641 99 <- Minus
chr3L 6132258..6132515 1..258 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:09 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 113..448 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:32:10 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 113..448 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:09:21 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 113..448 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:05:56 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 113..448 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:28 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 113..448 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:33:49 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..641 1..641 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:32:09 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..641 1..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:21 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 2..642 1..641 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:05:57 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..641 1..641 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:28 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 2..642 1..641 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:45 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6139223..6139605 259..641 100 <- Minus
3L 6139716..6139973 1..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:45 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6139223..6139605 259..641 100 <- Minus
3L 6139716..6139973 1..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:45 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6139223..6139605 259..641 100 <- Minus
3L 6139716..6139973 1..258 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:21 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6132323..6132705 259..641 100 <- Minus
arm_3L 6132816..6133073 1..258 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:44:05 Download gff for RE31218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6132323..6132705 259..641 100 <- Minus
3L 6132816..6133073 1..258 99   Minus

RE31218.hyp Sequence

Translation from 112 to 447

> RE31218.hyp
MQSSSICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGY
ETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADENG
FQPQGDHLPHN*

RE31218.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-PA 111 CG32405-PA 1..111 1..111 587 100 Plus
Acp65Aa-PA 105 CG10297-PA 5..104 8..109 293 52.4 Plus
Lcp65Ac-PA 109 CG6956-PA 3..104 7..110 289 55.8 Plus
Cpr65Aw-PA 117 CG32404-PA 11..104 16..109 287 54.3 Plus
Cpr65Ax1-PA 102 CG34270-PA 4..97 10..109 268 54 Plus

RE31218.pep Sequence

Translation from 112 to 447

> RE31218.pep
MQSSSICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGY
ETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADENG
FQPQGDHLPHN*

RE31218.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10920-PA 111 GF10920-PA 1..111 1..111 545 89.2 Plus
Dana\GF10919-PA 108 GF10919-PA 17..104 22..109 288 60.2 Plus
Dana\GF10917-PA 104 GF10917-PA 34..104 40..110 271 63.4 Plus
Dana\GF23520-PA 108 GF23520-PA 5..104 9..109 262 53.5 Plus
Dana\GF23526-PA 115 GF23526-PA 30..110 28..109 261 59.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14081-PA 111 GG14081-PA 1..111 1..111 573 95.5 Plus
Dere\GG14080-PA 108 GG14080-PA 4..105 9..110 295 52 Plus
Dere\GG14078-PA 105 GG14078-PA 28..105 33..110 285 60.3 Plus
Dere\GG15325-PA 108 GG15325-PA 5..105 9..110 274 52 Plus
Dere\GG15326-PA 109 GG15326-PA 3..104 7..110 272 56.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15653-PA 114 GH15653-PA 1..114 1..111 485 81.6 Plus
Dgri\GH15647-PA 105 GH15647-PA 5..105 6..110 311 55.2 Plus
Dgri\GH15652-PA 100 GH15652-PA 14..92 31..109 293 67.1 Plus
Dgri\GH15836-PA 110 GH15836-PA 5..106 9..111 262 53.4 Plus
Dgri\GH15646-PA 103 GH15646-PA 18..102 24..110 257 58.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-PA 111 CG32405-PA 1..111 1..111 587 100 Plus
Acp65Aa-PA 105 CG10297-PA 5..104 8..109 293 52.4 Plus
Lcp65Ac-PA 109 CG6956-PA 3..104 7..110 289 55.8 Plus
Cpr65Aw-PA 117 CG32404-PA 11..104 16..109 287 54.3 Plus
Cpr65Ax2-PB 102 CG18777-PB 4..97 10..109 268 54 Plus
Cpr65Ax2-PA 102 CG18777-PA 4..97 10..109 268 54 Plus
Cpr65Ax1-PA 102 CG34270-PA 4..97 10..109 268 54 Plus
Lcp65Ad-PB 108 CG6955-PB 5..104 9..109 263 50.5 Plus
Lcp65Ad-PA 108 CG6955-PA 5..104 9..109 263 50.5 Plus
Lcp65Af-PA 100 CG10533-PA 20..95 33..109 240 57.1 Plus
Lcp65Ag2-PA 105 CG10534-PA 9..100 15..109 220 46.3 Plus
Lcp65Ag1-PA 105 CG10530-PA 9..100 15..109 220 46.3 Plus
Cpr65Aw-PB 86 CG32404-PB 14..73 50..109 219 61.7 Plus
Lcp65Ag3-PA 105 CG18779-PA 9..100 15..109 217 45.3 Plus
Lcp65Aa-PA 102 CG7287-PA 3..101 5..110 216 41.5 Plus
Lcp65Ae-PA 99 CG10529-PA 5..96 6..109 213 44.2 Plus
Cpr49Ae-PA 134 CG8505-PA 1..109 1..109 203 42.5 Plus
Cpr65Au-PB 106 CG18778-PB 8..101 11..104 194 41.1 Plus
Cpr65Au-PA 106 CG18778-PA 8..101 11..104 194 41.1 Plus
Cpr65Az-PA 239 CG12330-PA 123..193 41..109 192 53.5 Plus
Cpr47Ef-PD 601 CG13214-PD 126..212 23..109 191 43.7 Plus
Cpr47Ef-PC 612 CG13214-PC 126..212 23..109 191 43.7 Plus
Cpr47Ea-PA 135 CG9079-PA 7..119 3..109 187 37.9 Plus
Cpr49Aa-PB 144 CG30045-PB 5..109 9..109 184 39 Plus
Cpr47Eb-PA 214 CG13224-PA 4..111 9..109 181 37 Plus
Lcp65Ab1-PA 104 CG32400-PA 21..99 31..109 178 46.2 Plus
Lcp65Ab2-PA 104 CG18773-PA 21..99 31..109 178 46.2 Plus
Cpr49Ag-PA 134 CG8511-PA 5..130 8..109 176 36.5 Plus
Cpr65Eb-PA 179 CG8638-PA 2..101 4..109 174 39.8 Plus
Cpr78Cc-PA 119 CG7658-PA 4..96 9..109 170 37.3 Plus
Cpr11B-PB 195 CG2555-PB 72..147 33..109 166 41.6 Plus
Cpr11B-PA 197 CG2555-PA 72..147 33..109 166 41.6 Plus
Cpr78E-PA 137 CG7160-PA 6..106 6..105 161 37.1 Plus
Cpr47Ee-PA 369 CG13222-PA 104..185 30..109 159 41 Plus
Cpr67Fb-PA 122 CG18348-PA 7..94 11..109 150 40.4 Plus
Edg78E-PB 122 CG7673-PB 8..93 17..109 150 37.9 Plus
Edg78E-PA 122 CG7673-PA 8..93 17..109 150 37.9 Plus
Cpr49Af-PB 126 CG8510-PB 35..98 46..109 149 43.8 Plus
Cpr49Af-PA 126 CG8510-PA 35..98 46..109 149 43.8 Plus
Cpr49Ab-PA 259 CG30042-PA 166..235 39..109 149 36.6 Plus
Cpr47Ec-PA 131 CG9077-PA 18..102 21..105 148 35.3 Plus
Cpr67Fa1-PA 134 CG7941-PA 5..97 9..109 145 33.7 Plus
Cpr67Fa2-PA 134 CG18349-PA 5..97 9..109 144 32.7 Plus
Cpr49Ad-PA 166 CG8836-PA 60..140 24..103 140 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12698-PA 111 GI12698-PA 1..111 1..111 511 84.7 Plus
Dmoj\GI12694-PA 101 GI12694-PA 16..101 22..110 302 61.8 Plus
Dmoj\GI12627-PA 112 GI12627-PA 2..107 5..109 267 48.6 Plus
Dmoj\GI12618-PA 110 GI12618-PA 5..105 9..110 262 55.9 Plus
Dmoj\GI12628-PA 104 GI12628-PA 2..102 5..109 259 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15515-PA 111 GL15515-PA 1..111 1..111 537 87.4 Plus
Dper\GL15514-PA 120 GL15514-PA 13..113 9..110 287 52.9 Plus
Dper\GL15557-PA 109 GL15557-PA 28..104 33..110 261 64.1 Plus
Dper\GL15560-PA 102 GL15560-PA 3..101 7..110 249 50 Plus
Dper\GL15556-PA 108 GL15556-PA 25..104 29..109 247 58 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16877-PA 111 GA16877-PA 1..111 1..111 537 87.4 Plus
Dpse\GA10226-PA 135 GA10226-PA 36..135 8..110 312 53.4 Plus
Dpse\GA16876-PA 120 GA16876-PA 13..113 9..110 287 52.9 Plus
Dpse\GA19982-PA 109 GA19982-PA 28..104 33..110 261 64.1 Plus
Dpse\GA19981-PA 108 GA19981-PA 25..104 29..109 247 58 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13864-PA 111 GM13864-PA 1..111 1..111 578 97.3 Plus
Dsec\GM13861-PA 105 GM13861-PA 4..105 7..110 298 51.4 Plus
Dsec\GM13863-PA 108 GM13863-PA 11..104 16..109 296 56.4 Plus
Dsec\GM14760-PA 109 GM14760-PA 3..104 7..110 273 56.7 Plus
Dsec\GM19678-PA 109 GM19678-PA 3..104 7..110 273 56.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13147-PA 111 GD13147-PA 1..111 1..111 578 97.3 Plus
Dsim\GD13144-PA 105 GD13144-PA 4..105 7..110 298 51.4 Plus
Dsim\GD13146-PA 108 GD13146-PA 11..104 16..109 287 55.3 Plus
Dsim\GD13939-PA 107 GD13939-PA 3..102 7..110 267 56.7 Plus
Dsim\GD13938-PA 108 GD13938-PA 25..104 29..109 247 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12683-PA 111 GJ12683-PA 1..111 1..111 490 80.2 Plus
Dvir\Acp65A-PA 105 GJ12679-PA 28..105 33..110 300 65.4 Plus
Dvir\GJ12682-PA 111 GJ12682-PA 6..104 8..110 287 50.5 Plus
Dvir\GJ12738-PA 110 GJ12738-PA 1..106 1..109 283 51.4 Plus
Dvir\GJ12740-PA 110 GJ12740-PA 4..105 8..110 256 52.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16920-PA 111 GK16920-PA 1..111 1..111 532 87.4 Plus
Dwil\GK16917-PA 107 GK16917-PA 1..107 1..110 310 50.9 Plus
Dwil\GK16919-PA 89 GK16919-PA 2..80 31..109 281 60.8 Plus
Dwil\GK17269-PA 108 GK17269-PA 5..103 9..110 276 53.9 Plus
Dwil\GK16921-PA 105 GK16921-PA 3..100 9..109 262 51.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20507-PA 111 GE20507-PA 1..111 1..111 566 94.6 Plus
Dyak\GE20502-PA 195 GE20502-PA 4..105 7..110 297 51.4 Plus
Dyak\GE20506-PA 108 GE20506-PA 11..105 16..110 294 54.7 Plus
Dyak\GE21543-PA 108 GE21543-PA 25..104 29..109 251 56.8 Plus
Dyak\GE20503-PA 102 GE20503-PA 3..101 7..110 210 43.3 Plus
Dyak\GE20502-PA 195 GE20502-PA 130..193 46..109 183 55.4 Plus