Clone RE31307 Report

Search the DGRC for RE31307

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:313
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG14229-RA
Protein status:RE31307.pep: gold
Preliminary Size:321
Sequenced Size:796

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14229 2001-12-14 Blastp of sequenced clone
CG14229 2002-01-01 Sim4 clustering to Release 2
CG14229 2003-01-01 Sim4 clustering to Release 3
CG14229 2008-04-29 Release 5.5 accounting
CG14229 2008-08-15 Release 5.9 accounting
CG14229 2008-12-18 5.12 accounting

Clone Sequence Records

RE31307.complete Sequence

796 bp (796 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071286

> RE31307.complete
GGTGGATGTCGCTGCTGTGAAACGGGGCAGGACAAAACAATTGACCAATA
GGAACCGAAACCAACACACTGCACTGGCCCCGGGATCGGAATGGCTGGAT
TCCTGAAGACAAGAAAGCGCAGCCGGGAGGATGAACTGGCCTGCGAGTCG
CCCCTTTCGAAGCGCATCAACAACCTGAATCTGAACTACGAGGATGGGAA
CAGCAGCAGCAGCAGCAGCTGCAGCATTCCGCCACTGTCGGGAGGAGGAG
CGACTGGTGGATCCGGCGGGTCCGATGCAGCCGGAAACGGTGTGGCGGCC
GGATACGAATACAACCCAGAACTGGGAGCCGAACAAAACCCATTTTACTA
CGAGAAGAACAAGATGCTGTACGACCTGCATGTCGAGCGCATCAAGCGGA
GCAGCCAGTAGCTAGTGATCATGGATTCCGGTGTGCGAGTCCAAGTCCTG
GCACAGCCATTTAAGTGCCAACACGAGTTATCTGCAGCAACACTCTCTCT
AGGTTCAAAGTAATTCGCCTCCGTTCAGTCTTCTCTGCGCACGGATTCGG
ATATCCGTGTCTGGAGTCACTTGCGTTTGTGTGATAAGCATTGTTTACTT
GCATGGCATTAGCATCACCCCTGATGCATACACATAATAATAGTAGTATA
AATTGAGCTAAGAGTCCCCCAAACACGCACATGAATATATATAAACTATG
TTCATCGGTTACCATCCCTTCAATATGTATTTATAATCCTGCATGTATAA
TTTATTCTAAGAATAATGTAAGAAAACCTCAAAAAAAAAAAAAAAA

RE31307.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RA 1210 CG14229-RA 210..989 1..780 3900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19582970..19583638 780..112 3345 100 Minus
chrX 22417052 chrX 19583701..19583813 113..1 565 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694198..19694866 780..112 3345 100 Minus
X 23542271 X 19694929..19695041 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19702296..19702964 780..112 3345 100 Minus
X 23527363 X 19703027..19703139 113..1 565 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:22:28 has no hits.

RE31307.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:23:23 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19582970..19583636 114..780 96 <- Minus
chrX 19583701..19583813 1..113 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:11 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 91..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:10 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 91..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:51 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 91..411 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:33 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 91..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:36:30 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 91..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:35:42 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..780 1..780 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:10 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..780 1..780 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:51 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 18..797 1..780 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:34 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..780 1..780 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:36:30 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 18..797 1..780 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:23 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
X 19694198..19694864 114..780 100 <- Minus
X 19694929..19695041 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:23 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
X 19694198..19694864 114..780 100 <- Minus
X 19694929..19695041 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:23 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
X 19694198..19694864 114..780 100 <- Minus
X 19694929..19695041 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:51 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588231..19588897 114..780 100 <- Minus
arm_X 19588962..19589074 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:12 Download gff for RE31307.complete
Subject Subject Range Query Range Percent Splice Strand
X 19702296..19702962 114..780 100 <- Minus
X 19703027..19703139 1..113 100   Minus

RE31307.pep Sequence

Translation from 90 to 410

> RE31307.pep
MAGFLKTRKRSREDELACESPLSKRINNLNLNYEDGNSSSSSSCSIPPLS
GGGATGGSGGSDAAGNGVAAGYEYNPELGAEQNPFYYEKNKMLYDLHVER
IKRSSQ*

RE31307.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20268-PA 110 GF20268-PA 1..110 1..106 337 69.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18030-PA 107 GG18030-PA 1..107 1..106 446 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12257-PA 115 GH12257-PA 1..115 1..106 308 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PB 106 CG14229-PB 1..106 1..106 554 100 Plus
CG14229-PC 106 CG14229-PC 1..106 1..106 554 100 Plus
CG14229-PA 106 CG14229-PA 1..106 1..106 554 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11017-PA 112 GI11017-PA 1..112 1..106 309 62.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18306-PA 131 GL18306-PA 1..131 1..106 281 55.3 Plus
Dper\GL25995-PA 87 GL25995-PA 1..84 1..106 132 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27433-PA 103 GA27433-PA 1..103 1..106 301 64.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22715-PA 140 GM22715-PA 43..140 9..106 358 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24449-PA 106 GD24449-PA 1..106 1..106 442 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15617-PA 114 GJ15617-PA 1..114 1..106 319 67.8 Plus
Dvir\GJ24051-PA 110 GJ24051-PA 1..108 1..104 141 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15919-PA 129 GK15919-PA 1..129 1..106 287 55.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17359-PA 112 GE17359-PA 1..112 1..106 404 81.2 Plus

RE31307.hyp Sequence

Translation from 90 to 410

> RE31307.hyp
MAGFLKTRKRSREDELACESPLSKRINNLNLNYEDGNSSSSSSCSIPPLS
GGGATGGSGGSDAAGNGVAAGYEYNPELGAEQNPFYYEKNKMLYDLHVER
IKRSSQ*

RE31307.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PB 106 CG14229-PB 1..106 1..106 554 100 Plus
CG14229-PC 106 CG14229-PC 1..106 1..106 554 100 Plus
CG14229-PA 106 CG14229-PA 1..106 1..106 554 100 Plus