Clone RE31520 Report

Search the DGRC for RE31520

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:315
Well:20
Vector:pFlc-1
Associated Gene/TranscriptCG9667-RA
Protein status:RE31520.pep: gold
Preliminary Size:856
Sequenced Size:876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9667 2002-01-01 Sim4 clustering to Release 2
CG9667 2002-01-18 Blastp of sequenced clone
CG9667 2008-04-29 Release 5.5 accounting
CG9667 2008-08-15 Release 5.9 accounting
CG9667 2008-12-18 5.12 accounting

Clone Sequence Records

RE31520.complete Sequence

876 bp (876 high quality bases) assembled on 2002-01-18

GenBank Submission: AY084151

> RE31520.complete
AAGAAGTTAGTAAACAAAATGGCGCGCAATGCAGAGAAGGCAATGACAAC
TTTGGCACGTTGGCGGGCCGCAAAAGAAGTGGAATCTGGTGAAAAGGAAC
GCCGGCCCTATTTGGCCTCCGAGTGCCACGATTTGCCCAGATGTGAGAAG
TTCCGCCTGGAGATAATACGCGACATATCGAAGAAGGTGGCCCAGATACA
GAATGCTGGCTTGGGAGAATTCCGGATTCGCGATCTGAACGATGAAATCA
ACAAGTTATTGCGTGAGAAACGGCATTGGGAAAATCAGATATCCTCATTG
GGTGGCCCCCACTATAGACGCTATGGTCCCAAGATGTTCGATGCGGAGGG
CCGTGAAGTTCCCGGCAATCGAGGCTACAAATACTTTGGAGCCGCCAAGG
ATCTGCCGGGTGTTCGCGAGCTCTTTGAACAGGATCCTCCGCCGCCACCC
AGGAAATCACGCGCTGAACTAATGAAGGACATAGATGCCGAATACTACGG
CTATCGAGATGACGAAGATGGTGTTCTGATCCCTCTGGAGGAACGCATCG
AACGAGCGGCCATTCAGAAGGCCGTGCAGGAATGGCGGGAGAAAATGGCC
AGAGATGGTCGCATAATCGATGACGAAGAGGAGGATGAAATATATCCCCT
TTCGGGACCAGCACGCGAAGCCATCGAGGATGCCAAGGCTCGAGCCGCCG
TGGAGGATCCTCATGGCCTATTGGCATCCAAGTTCACCGCTCACGTTCCC
GTGCCGACGCAACAAGATGTACAGGAAGCACTGCTGCGCCAGCGGAAACG
GGAACTGCTGGAGAAATACGCCGGTGGCACTAACTAAGCTCAATAAACAT
TCTAAACTCCAAAAAAAAAAAAAAAA

RE31520.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9667-RA 905 CG9667-RA 33..891 1..859 4295 100 Plus
CG9667.a 1018 CG9667.a 177..1015 21..859 4195 100 Plus
CG9667.b 878 CG9667.b 38..875 22..859 4190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3951321..3951975 859..205 3260 99.8 Minus
chr3R 27901430 chr3R 3952036..3952196 205..45 805 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8125290..8125944 859..205 3275 100 Minus
3R 32079331 3R 8126005..8126165 205..45 805 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7866121..7866775 859..205 3275 100 Minus
3R 31820162 3R 7866836..7866996 205..45 805 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:23:00 has no hits.

RE31520.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:23:38 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3951320..3951974 206..860 99 <- Minus
chr3R 3952036..3952196 45..205 100 <- Minus
chr3R 3952260..3952282 22..44 100 <- Minus
chr3R 3952344..3952364 1..21 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:19 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..819 19..837 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:45:01 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..819 19..837 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:05 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..819 19..837 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:13:17 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..819 19..837 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:07 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..819 19..837 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:09:31 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..859 1..860 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:45:00 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..859 1..860 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:05 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 25..883 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:13:17 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 1..859 1..860 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:07 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
CG9667-RA 25..883 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:38 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8125289..8125943 206..860 99 <- Minus
3R 8126005..8126165 45..205 100 <- Minus
3R 8126229..8126251 22..44 100 <- Minus
3R 8126313..8126333 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:38 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8125289..8125943 206..860 99 <- Minus
3R 8126005..8126165 45..205 100 <- Minus
3R 8126229..8126251 22..44 100 <- Minus
3R 8126313..8126333 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:23:38 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8125289..8125943 206..860 99 <- Minus
3R 8126005..8126165 45..205 100 <- Minus
3R 8126229..8126251 22..44 100 <- Minus
3R 8126313..8126333 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:05 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3951011..3951665 206..860 99 <- Minus
arm_3R 3951727..3951887 45..205 100 <- Minus
arm_3R 3951951..3951973 22..44 100 <- Minus
arm_3R 3952035..3952055 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:28 Download gff for RE31520.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7866120..7866774 206..860 99 <- Minus
3R 7866836..7866996 45..205 100 <- Minus
3R 7867060..7867082 22..44 100 <- Minus
3R 7867144..7867164 1..21 100   Minus

RE31520.hyp Sequence

Translation from 0 to 836

> RE31520.hyp
KKLVNKMARNAEKAMTTLARWRAAKEVESGEKERRPYLASECHDLPRCEK
FRLEIIRDISKKVAQIQNAGLGEFRIRDLNDEINKLLREKRHWENQISSL
GGPHYRRYGPKMFDAEGREVPGNRGYKYFGAAKDLPGVRELFEQDPPPPP
RKSRAELMKDIDAEYYGYRDDEDGVLIPLEERIERAAIQKAVQEWREKMA
RDGRIIDDEEEDEIYPLSGPAREAIEDAKARAAVEDPHGLLASKFTAHVP
VPTQQDVQEALLRQRKRELLEKYAGGTN*

RE31520.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9667-PA 272 CG9667-PA 1..272 7..278 1423 100 Plus
CG9667-PB 264 CG9667-PB 1..264 15..278 1385 100 Plus

RE31520.pep Sequence

Translation from 0 to 836

> RE31520.pep
KKLVNKMARNAEKAMTTLARWRAAKEVESGEKERRPYLASECHDLPRCEK
FRLEIIRDISKKVAQIQNAGLGEFRIRDLNDEINKLLREKRHWENQISSL
GGPHYRRYGPKMFDAEGREVPGNRGYKYFGAAKDLPGVRELFEQDPPPPP
RKSRAELMKDIDAEYYGYRDDEDGVLIPLEERIERAAIQKAVQEWREKMA
RDGRIIDDEEEDEIYPLSGPAREAIEDAKARAAVEDPHGLLASKFTAHVP
VPTQQDVQEALLRQRKRELLEKYAGGTN*

RE31520.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18268-PA 273 GF18268-PA 1..273 7..278 1368 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17474-PA 272 GG17474-PA 1..272 7..278 1398 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19249-PA 273 GH19249-PA 1..273 7..278 1255 90.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9667-PA 272 CG9667-PA 1..272 7..278 1423 100 Plus
CG9667-PB 264 CG9667-PB 1..264 15..278 1385 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24285-PA 273 GI24285-PA 1..273 7..278 1216 91.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23279-PA 274 GL23279-PA 1..274 7..278 1265 94.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21951-PA 272 GA21951-PA 4..272 12..278 1220 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26367-PA 272 GM26367-PA 1..272 7..278 1400 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20890-PA 272 GD20890-PA 1..272 7..278 1403 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23062-PA 274 GJ23062-PA 1..274 7..278 1262 90.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12885-PA 275 GK12885-PA 1..275 7..278 1266 88.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24874-PA 272 GE24874-PA 1..272 7..278 1398 98.2 Plus