BDGP Sequence Production Resources |
Search the DGRC for RE31692
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 316 |
Well: | 92 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Neb-cGP-RA |
Protein status: | RE31692.pep: gold |
Sequenced Size: | 417 |
Gene | Date | Evidence |
---|---|---|
CG15304 | 2001-12-14 | Blastp of sequenced clone |
CG15304 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15304 | 2003-01-01 | Sim4 clustering to Release 3 |
Neb-cGP | 2008-04-29 | Release 5.5 accounting |
Neb-cGP | 2008-08-15 | Release 5.9 accounting |
Neb-cGP | 2008-12-18 | 5.12 accounting |
417 bp (417 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071289
> RE31692.complete ATCGAAGACCGATAGACCTCGATAGACTCAGTTGTATAACCTCTGCTCGC AAATATTTTTTACAGGCAACTAGCAGCTCGAATTCCGTGCAAATAAACCT TTAAAAATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGTCGAAAATCTT CAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAGGCCACGTACG CCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCCCAAGAAGAAG TAGAGGGATGCAACTGCTCCAACGCGGCTACAACTCATCCGCCACAATCG ATGTCTTGGATCCGGGGCCATCGCTGGACTGCGGATCAGTTTATTTTATG TGTAGTGCAAGACCTTGAAGGAATAAATAAGCTGAGAATGTAACACACTG CAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10352572..10352790 | 182..400 | 1095 | 100 | Plus |
chrX | 22417052 | chrX | 10352235..10352338 | 1..104 | 520 | 100 | Plus |
chrX | 22417052 | chrX | 10352410..10352489 | 105..184 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy4 | 6852 | gypsy4 GYPSY4 6852bp | 3699..3738 | 48..89 | 115 | 78.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10352235..10352338 | 1..104 | 100 | -> | Plus |
chrX | 10352410..10352486 | 105..181 | 100 | -> | Plus |
chrX | 10352572..10352790 | 182..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 1..147 | 107..253 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 1..147 | 107..253 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 1..147 | 107..253 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 1..147 | 107..253 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 1..147 | 107..253 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 2..401 | 1..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 2..401 | 1..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 10..409 | 1..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 2..401 | 1..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Neb-cGP-RA | 10..409 | 1..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10460745..10460848 | 1..104 | 100 | -> | Plus |
X | 10460920..10460996 | 105..181 | 100 | -> | Plus |
X | 10461082..10461300 | 182..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10460745..10460848 | 1..104 | 100 | -> | Plus |
X | 10460920..10460996 | 105..181 | 100 | -> | Plus |
X | 10461082..10461300 | 182..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10460745..10460848 | 1..104 | 100 | -> | Plus |
X | 10460920..10460996 | 105..181 | 100 | -> | Plus |
X | 10461082..10461300 | 182..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10354778..10354881 | 1..104 | 100 | -> | Plus |
arm_X | 10354953..10355029 | 105..181 | 100 | -> | Plus |
arm_X | 10355115..10355333 | 182..401 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10469180..10469398 | 182..401 | 99 | Plus | |
X | 10468843..10468946 | 1..104 | 100 | -> | Plus |
X | 10469018..10469094 | 105..181 | 100 | -> | Plus |
Translation from 106 to 252
> RE31692.pep MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19337-PA | 48 | GF19337-PA | 1..48 | 1..48 | 234 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18357-PA | 48 | GG18357-PA | 1..48 | 1..48 | 228 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12017-PA | 48 | GH12017-PA | 1..48 | 1..48 | 219 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Neb-cGP-PB | 48 | CG15304-PB | 1..48 | 1..48 | 237 | 100 | Plus |
Neb-cGP-PA | 48 | CG15304-PA | 1..48 | 1..48 | 237 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15198-PA | 48 | GI15198-PA | 1..48 | 1..48 | 225 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14971-PA | 48 | GL14971-PA | 1..48 | 1..48 | 229 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13636-PA | 48 | GA13636-PA | 1..48 | 1..48 | 229 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24782-PA | 48 | GD24782-PA | 1..48 | 1..48 | 237 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14804-PA | 48 | GJ14804-PA | 1..48 | 1..48 | 211 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19768-PA | 48 | GK19768-PA | 1..48 | 1..48 | 231 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17844-PA | 48 | GE17844-PA | 1..48 | 1..48 | 237 | 100 | Plus |
Translation from 106 to 252
> RE31692.hyp MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*