Clone RE31692 Report

Search the DGRC for RE31692

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:316
Well:92
Vector:pFlc-1
Associated Gene/TranscriptNeb-cGP-RA
Protein status:RE31692.pep: gold
Sequenced Size:417

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15304 2001-12-14 Blastp of sequenced clone
CG15304 2002-01-01 Sim4 clustering to Release 2
CG15304 2003-01-01 Sim4 clustering to Release 3
Neb-cGP 2008-04-29 Release 5.5 accounting
Neb-cGP 2008-08-15 Release 5.9 accounting
Neb-cGP 2008-12-18 5.12 accounting

Clone Sequence Records

RE31692.complete Sequence

417 bp (417 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071289

> RE31692.complete
ATCGAAGACCGATAGACCTCGATAGACTCAGTTGTATAACCTCTGCTCGC
AAATATTTTTTACAGGCAACTAGCAGCTCGAATTCCGTGCAAATAAACCT
TTAAAAATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGTCGAAAATCTT
CAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAGGCCACGTACG
CCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCCCAAGAAGAAG
TAGAGGGATGCAACTGCTCCAACGCGGCTACAACTCATCCGCCACAATCG
ATGTCTTGGATCCGGGGCCATCGCTGGACTGCGGATCAGTTTATTTTATG
TGTAGTGCAAGACCTTGAAGGAATAAATAAGCTGAGAATGTAACACACTG
CAAAAAAAAAAAAAAAA

RE31692.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RA 743 Neb-cGP-RA 121..520 1..400 2000 100 Plus
Neb-cGP.a 987 Neb-cGP.a 121..520 1..400 2000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10352572..10352790 182..400 1095 100 Plus
chrX 22417052 chrX 10352235..10352338 1..104 520 100 Plus
chrX 22417052 chrX 10352410..10352489 105..184 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10461082..10461300 182..400 1095 100 Plus
X 23542271 X 10460745..10460848 1..104 520 100 Plus
X 23542271 X 10460920..10460999 105..184 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10469180..10469398 182..400 1095 100 Plus
X 23527363 X 10468843..10468946 1..104 520 100 Plus
X 23527363 X 10469018..10469097 105..184 400 100 Plus
Blast to na_te.dros performed 2019-03-16 01:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 3699..3738 48..89 115 78.6 Plus

RE31692.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:54:52 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10352235..10352338 1..104 100 -> Plus
chrX 10352410..10352486 105..181 100 -> Plus
chrX 10352572..10352790 182..401 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:25 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 107..253 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:46 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 107..253 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:23 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 107..253 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:57 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 107..253 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:34 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 107..253 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:34 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 2..401 1..401 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:46 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 2..401 1..401 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:23 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 10..409 1..401 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:57 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 2..401 1..401 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:34 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 10..409 1..401 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:52 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
X 10460745..10460848 1..104 100 -> Plus
X 10460920..10460996 105..181 100 -> Plus
X 10461082..10461300 182..401 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:52 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
X 10460745..10460848 1..104 100 -> Plus
X 10460920..10460996 105..181 100 -> Plus
X 10461082..10461300 182..401 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:52 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
X 10460745..10460848 1..104 100 -> Plus
X 10460920..10460996 105..181 100 -> Plus
X 10461082..10461300 182..401 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:23 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354778..10354881 1..104 100 -> Plus
arm_X 10354953..10355029 105..181 100 -> Plus
arm_X 10355115..10355333 182..401 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:29 Download gff for RE31692.complete
Subject Subject Range Query Range Percent Splice Strand
X 10469180..10469398 182..401 99   Plus
X 10468843..10468946 1..104 100 -> Plus
X 10469018..10469094 105..181 100 -> Plus

RE31692.pep Sequence

Translation from 106 to 252

> RE31692.pep
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*

RE31692.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19337-PA 48 GF19337-PA 1..48 1..48 234 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18357-PA 48 GG18357-PA 1..48 1..48 228 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12017-PA 48 GH12017-PA 1..48 1..48 219 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-PB 48 CG15304-PB 1..48 1..48 237 100 Plus
Neb-cGP-PA 48 CG15304-PA 1..48 1..48 237 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15198-PA 48 GI15198-PA 1..48 1..48 225 93.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14971-PA 48 GL14971-PA 1..48 1..48 229 93.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13636-PA 48 GA13636-PA 1..48 1..48 229 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24782-PA 48 GD24782-PA 1..48 1..48 237 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14804-PA 48 GJ14804-PA 1..48 1..48 211 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19768-PA 48 GK19768-PA 1..48 1..48 231 95.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17844-PA 48 GE17844-PA 1..48 1..48 237 100 Plus

RE31692.hyp Sequence

Translation from 106 to 252

> RE31692.hyp
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*

RE31692.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-PB 48 CG15304-PB 1..48 1..48 237 100 Plus
Neb-cGP-PA 48 CG15304-PA 1..48 1..48 237 100 Plus