Clone RE31802 Report

Search the DGRC for RE31802

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:318
Well:2
Vector:pFlc-1
Associated Gene/Transcriptborr-RB
Protein status:RE31802.pep: gold
Preliminary Size:1296
Sequenced Size:1309

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4454 2002-10-01 Blastp of sequenced clone
Borr 2008-04-29 Release 5.5 accounting
Borr 2008-08-15 Release 5.9 accounting
borr 2008-12-18 5.12 accounting

Clone Sequence Records

RE31802.complete Sequence

1309 bp (1309 high quality bases) assembled on 2002-10-01

GenBank Submission: BT001609

> RE31802.complete
ACTGTTCCATGACGCTTGAATTTTAGCGGACAAACTCGAAAAGAAATAGC
AAAAAGACGACGCTTGCTACGAAAATAGTTATTCCTCGCAAAAACCCTGT
AACGTGTAAACAAAGGCCGCTGCCACGATGCCGCGCACCAAGATACCAAA
GAACTCCAAACGCAACCGCGAGGTGGCCAATCGCGAAGAGAAGGTGCGCC
TGTACGAGCTGAAAATGGATTCCCGCCTTATCAGCATCGATTCGCTGGAG
ACCAAGTTCCTCTCCGCCGTGGACCACCAGGTGAAGACACTGCTCGGCCA
GGTGCAGAAGGAGCTGGCCAATCTGAAGATGCCCGAAGTGCTGCGCCTCT
TCGAGGAACTGGACCGCTTCAGCGACTTCAAGGCCAGCGATCAGACGCAG
CTGCTCGCCTCGATGTCCATGAGTGGCAGCGCCATCGAGGGCCACGCCCC
CTCCGCCACTGGAAGTCGCAATGACGAAGGCTACCTTACAGAGGACAGCA
GCATCGGTGCCAGCGGTGGGAGCATCCTGGCCGCCCACACAGGCTCCCTG
CTGCGGTCCACGAAGGCCATGCGCACACCCGGACCACTGCACTCGGCGAG
GGCTCGTCGAGCGCGGCGCAGTCGTTCCGCCTGCGGGGATCTCAACATAT
TGCACTCGGCCAAACCGCCGTCAATTTCGAGCAGCAGCAGCAGCAGCCGC
AATTCGCGCAGCAAACTGCGCACACCGATGGCCTCGCGTGCGAAGGCCTT
CAGTGCCGACCGCACTCCTTTGAAACAGAAGCAAATGCGCTCCGGATCGC
CAACTACACCGCCGATGGCATTCCTGCGCTATCCCAAGCCCGGCGAGGTG
GCACTATCCAAATACGGCAGTCCCATGGTGGCTCAAGTAATGCCAGACAA
GTTCGCCAATGTGAACATACCCATTCGGAACGGAGTTCTTAGCTTGCGGC
CCAAAAAACTGGATGCCGACGAGGTGGAGTCAAATCTGTTGGAGAACCTG
GACGAGGACACCCTTAACCAGATCAAAACGCTGCACGAGAACTTGCAGAT
GATTGTTAATAAGGCCAGCCAGGCGGTGTTCAAGTAGCTGTCATTTCAAA
CGCTTATCTAGATATAATGCTATATCATATATTTTAATACGTTTCGTTTA
AGTTCAGTTTTCATTTTACTCATTTAGTTCAAGTATTTTGTCTTTATTCA
TAAAGATCTATCGTATTTGCATAAGTTTCAATACATGTTCATATCCAAGT
GTACGGCGATTTAAATGTAATGTTTTAAATACATGCTTAATCCAAAAAAA
AAAAAAAAA

RE31802.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
borr-RB 1411 borr-RB 8..1313 1..1306 6515 99.9 Plus
borr.b 1654 borr.b 4..1309 1..1306 6515 99.9 Plus
borr.a 1642 borr.a 481..1297 490..1306 4070 99.8 Plus
borr.a 1642 borr.a 4..482 1..479 2395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9251565..9252044 480..1 2400 100 Minus
chr2L 23010047 chr2L 9250873..9251283 888..478 2055 100 Minus
chr2L 23010047 chr2L 9250403..9250807 1293..889 2010 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9252634..9253113 480..1 2400 100 Minus
2L 23513712 2L 9251459..9251876 1306..889 2075 99.8 Minus
2L 23513712 2L 9251942..9252352 888..478 2055 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9252634..9253113 480..1 2400 100 Minus
2L 23513712 2L 9251459..9251876 1306..889 2075 99.7 Minus
2L 23513712 2L 9251942..9252352 888..478 2055 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:25:29 has no hits.

RE31802.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:26:52 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9250873..9251281 480..888 100 <- Minus
chr2L 9250403..9250807 889..1293 99 <- Minus
chr2L 9251566..9252044 1..479 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:27 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 1..960 128..1087 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:12:53 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 1..960 128..1087 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:08 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 1..960 128..1087 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:03:58 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
Borr-RB 1..960 128..1087 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:12 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 1..960 128..1087 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:35:19 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 4..1296 1..1293 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:12:53 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 4..1296 1..1293 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:08 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 6..1298 1..1293 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:03:58 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
Borr-RB 4..1296 1..1293 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:12 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RB 6..1298 1..1293 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:52 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 889..1293 99 <- Minus
2L 9251942..9252350 480..888 100 <- Minus
2L 9252635..9253113 1..479 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:52 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 889..1293 99 <- Minus
2L 9251942..9252350 480..888 100 <- Minus
2L 9252635..9253113 1..479 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:26:52 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 889..1293 99 <- Minus
2L 9251942..9252350 480..888 100 <- Minus
2L 9252635..9253113 1..479 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:08 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9251472..9251876 889..1293 99 <- Minus
arm_2L 9251942..9252350 480..888 100 <- Minus
arm_2L 9252635..9253113 1..479 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:35:36 Download gff for RE31802.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 889..1293 99 <- Minus
2L 9251942..9252350 480..888 100 <- Minus
2L 9252635..9253113 1..479 100   Minus

RE31802.pep Sequence

Translation from 127 to 1086

> RE31802.pep
MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDH
QVKTLLGQVQKELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSG
SAIEGHAPSATGSRNDEGYLTEDSSIGASGGSILAAHTGSLLRSTKAMRT
PGPLHSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRSKLRTP
MASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPM
VAQVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIK
TLHENLQMIVNKASQAVFK*

RE31802.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22038-PA 318 GF22038-PA 1..318 1..319 1191 75.4 Plus
Dana\GF22049-PA 218 GF22049-PA 87..214 183..315 232 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24035-PA 312 GG24035-PA 1..312 1..319 1538 94.4 Plus
Dere\GG24036-PA 218 GG24036-PA 88..212 179..315 259 40.7 Plus
Dere\GG24036-PA 218 GG24036-PA 1..85 1..87 164 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13640-PA 316 GH13640-PA 1..316 1..319 888 61 Plus
Dgri\GH13271-PA 183 GH13271-PA 1..183 142..319 582 70.8 Plus
Dgri\GH13272-PA 225 GH13272-PA 87..221 177..315 266 45.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
borr-PB 319 CG4454-PB 1..319 1..319 1586 100 Plus
borr-PA 315 CG4454-PA 1..315 1..319 1549 98.7 Plus
aust-PB 216 CG17009-PB 88..210 179..315 236 41.4 Plus
aust-PA 216 CG17009-PA 88..210 179..315 236 41.4 Plus
aust-PB 216 CG17009-PB 1..98 1..99 178 41 Plus
aust-PA 216 CG17009-PA 1..98 1..99 178 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11901-PA 324 GI11901-PA 1..324 1..319 932 63 Plus
Dmoj\GI11912-PA 221 GI11912-PA 87..217 178..315 278 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25535-PA 318 GL25535-PA 1..318 1..319 1150 73.6 Plus
Dper\GL21274-PA 226 GL21274-PA 87..222 179..315 215 38.7 Plus
Dper\GL10058-PA 226 GL10058-PA 87..222 179..315 202 38 Plus
Dper\GL19675-PA 226 GL19675-PA 87..222 179..315 199 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18196-PA 318 GA18196-PA 1..318 1..319 1153 74.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12517-PA 314 GM12517-PA 1..314 1..319 1600 97.5 Plus
Dsec\GM12528-PA 217 GM12528-PA 86..211 177..315 243 38.8 Plus
Dsec\GM12528-PA 217 GM12528-PA 1..74 1..74 168 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22362-PA 315 GD22362-PA 1..315 1..319 1611 97.5 Plus
Dsim\GD22363-PA 216 GD22363-PA 86..210 177..315 237 38.7 Plus
Dsim\GD22363-PA 216 GD22363-PA 1..74 1..74 168 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14013-PA 325 GJ14013-PA 1..325 1..319 936 64.5 Plus
Dvir\GJ14024-PA 220 GJ14024-PA 89..216 179..315 263 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15062-PA 331 GK15062-PA 1..331 1..319 893 59.3 Plus
Dwil\GK15971-PA 257 GK15971-PA 1..257 30..319 490 43.2 Plus
Dwil\GK15063-PA 144 GK15063-PA 59..142 229..314 174 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10577-PA 313 GE10577-PA 1..313 1..319 1587 96.6 Plus
Dyak\GE10588-PA 218 GE10588-PA 88..212 179..315 257 42.1 Plus
Dyak\GE10588-PA 218 GE10588-PA 1..74 1..74 165 47.3 Plus

RE31802.hyp Sequence

Translation from 127 to 1086

> RE31802.hyp
MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDH
QVKTLLGQVQKELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSG
SAIEGHAPSATGSRNDEGYLTEDSSIGASGGSILAAHTGSLLRSTKAMRT
PGPLHSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRSKLRTP
MASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPM
VAQVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIK
TLHENLQMIVNKASQAVFK*

RE31802.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
borr-PB 319 CG4454-PB 1..319 1..319 1586 100 Plus
borr-PA 315 CG4454-PA 1..315 1..319 1549 98.7 Plus
aust-PB 216 CG17009-PB 88..210 179..315 236 41.4 Plus
aust-PA 216 CG17009-PA 88..210 179..315 236 41.4 Plus
aust-PB 216 CG17009-PB 1..98 1..99 178 41 Plus
aust-PA 216 CG17009-PA 1..98 1..99 178 41 Plus