Clone RE32113 Report

Search the DGRC for RE32113

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:321
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCpr78Cc-RA
Protein status:RE32113.pep: gold
Preliminary Size:511
Sequenced Size:534

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7658 2002-01-01 Sim4 clustering to Release 2
CG7658 2002-04-21 Blastp of sequenced clone
CG7658 2003-01-01 Sim4 clustering to Release 3
Cpr78Cc 2008-04-29 Release 5.5 accounting
Cpr78Cc 2008-08-15 Release 5.9 accounting
Cpr78Cc 2008-12-18 5.12 accounting

Clone Sequence Records

RE32113.complete Sequence

534 bp (534 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113448

> RE32113.complete
GGTGAGGATTATACAAGCCAAGAAACCAGCAAGATGTTTAAGCTATCGCT
CTGCCTGCTCGCCGCTCTGATGCTGGCCAATGTGTATGCGGACAACATAA
ACAAGGATGCCGTGATCACCCGCGAGGATGTTAATCCTGCCGACGCCGAG
GGCAACTACCAATACGCCTTCGAGACCAGCAATGGTATTCAGGCCCAGGA
GGCCGGAAACGTCAATGGCATTAGCGGAAGCAGCTCTTACATCTCCCCCG
AAGGCGTCCCCATCTCACTGACCTACGTCGCCGATGAAAACGGCTTCCAG
CCTCAGGGCGATCACCTTCCCACCGCTCCCCCAATCCCGGAGGCCATCCT
CCGCGCCCTGGAATACATCGCCGCCCACCCTCCACAGCCCTAAATCCCCG
ATTGGATACCCCATTCAAAGCCTAGTCAGTGCTTTTGCTAAACATGAGTT
ATATCTAGTTCTAGAAAGTCTGTACATAAATCCCCCAAAAAATAAAAACA
TAAATAGTTACATCAAAGAAAAAAAAAAAAAAAA

RE32113.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Cc-RA 935 Cpr78Cc-RA 277..792 2..517 2580 100 Plus
Edg78E-RA 1129 Edg78E-RA 324..399 140..215 215 85.5 Plus
Edg78E.a 1320 Edg78E.a 515..590 140..215 215 85.5 Plus
Edg78E-RA 1129 Edg78E-RA 420..553 236..369 145 73.8 Plus
Edg78E.a 1320 Edg78E.a 611..744 236..369 145 73.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21289711..21290182 46..517 2360 100 Plus
chr3L 24539361 chr3L 21286335..21286564 369..140 250 73.9 Minus
chr3L 24539361 chr3L 21289597..21289640 2..45 220 100 Plus
chr3L 24539361 chr3L 6153942..6154000 265..323 190 88.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21300703..21301174 46..517 2360 100 Plus
3L 28110227 3L 21297327..21297556 369..140 250 73.9 Minus
3L 28110227 3L 21300589..21300632 2..45 220 100 Plus
3L 28110227 3L 6161392..6161450 265..323 190 88.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21293803..21294274 46..517 2360 100 Plus
3L 28103327 3L 21293689..21293732 2..45 220 100 Plus
3L 28103327 3L 21290581..21290656 215..140 215 85.5 Minus
3L 28103327 3L 6154492..6154550 265..323 190 88.1 Plus
3L 28103327 3L 21290427..21290560 369..236 145 73.8 Minus
Blast to na_te.dros performed 2019-03-16 19:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 1905..1962 460..517 110 65.5 Plus

RE32113.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:42:31 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21289596..21289640 1..45 97 -> Plus
chr3L 21289711..21290182 46..518 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:36 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 1..360 34..393 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:13 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 1..360 34..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:19 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 1..360 34..393 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:29 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 1..360 34..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:41 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 1..360 34..393 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:11 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 2..516 2..516 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:13 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 2..516 2..516 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:19 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 9..522 1..514 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:29 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 2..516 2..516 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:41 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr78Cc-RA 9..522 1..514 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:31 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21300588..21300632 1..45 97 -> Plus
3L 21300703..21301174 46..518 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:31 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21300588..21300632 1..45 97 -> Plus
3L 21300703..21301174 46..518 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:31 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21300588..21300632 1..45 97 -> Plus
3L 21300703..21301174 46..518 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:19 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21293688..21293732 1..45 97 -> Plus
arm_3L 21293803..21294274 46..518 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:41 Download gff for RE32113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21293803..21294274 46..518 99   Plus
3L 21293688..21293732 1..45 97 -> Plus

RE32113.hyp Sequence

Translation from 0 to 392

> RE32113.hyp
SEDYTSQETSKMFKLSLCLLAALMLANVYADNINKDAVITREDVNPADAE
GNYQYAFETSNGIQAQEAGNVNGISGSSSYISPEGVPISLTYVADENGFQ
PQGDHLPTAPPIPEAILRALEYIAAHPPQP*

RE32113.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Cc-PA 119 CG7658-PA 1..119 12..130 616 100 Plus
Edg78E-PB 122 CG7673-PB 1..116 12..130 371 60.5 Plus
Edg78E-PA 122 CG7673-PA 1..116 12..130 371 60.5 Plus
Cpr49Aa-PB 144 CG30045-PB 43..132 50..130 269 56.7 Plus
Cpr67Fa2-PA 134 CG18349-PA 6..117 19..127 264 53 Plus

RE32113.pep Sequence

Translation from 33 to 392

> RE32113.pep
MFKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSN
GIQAQEAGNVNGISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPP
IPEAILRALEYIAAHPPQP*

RE32113.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10274-PA 119 GF10274-PA 1..118 1..118 432 83.1 Plus
Dana\GF24202-PA 115 GF24202-PA 1..109 1..117 328 55.6 Plus
Dana\GF24793-PA 181 GF24793-PA 1..121 1..116 267 53.7 Plus
Dana\GF10617-PA 121 GF10617-PA 1..114 1..116 264 48.7 Plus
Dana\GF10273-PA 139 GF10273-PA 36..128 23..115 242 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16171-PA 119 GG16171-PA 1..115 1..115 500 93.9 Plus
Dere\GG13245-PA 121 GG13245-PA 1..116 1..119 369 60.5 Plus
Dere\GG15459-PA 122 GG15459-PA 1..114 1..116 267 48.3 Plus
Dere\GG14999-PA 178 GG14999-PA 1..121 1..116 254 54.5 Plus
Dere\GG16170-PA 140 GG16170-PA 36..128 23..115 248 53.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15299-PA 118 GH15299-PA 1..117 1..118 404 66.9 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..114 1..117 368 60.7 Plus
Dgri\GH16084-PA 157 GH16084-PA 1..121 1..116 273 53.7 Plus
Dgri\GH20994-PA 124 GH20994-PA 1..117 1..116 260 52.1 Plus
Dgri\GH14974-PA 137 GH14974-PA 34..126 23..115 250 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr78Cc-PA 119 CG7658-PA 1..119 1..119 616 100 Plus
Edg78E-PB 122 CG7673-PB 1..116 1..119 371 60.5 Plus
Edg78E-PA 122 CG7673-PA 1..116 1..119 371 60.5 Plus
Cpr49Aa-PB 144 CG30045-PB 43..132 39..119 269 56.7 Plus
Cpr67Fa2-PA 134 CG18349-PA 6..117 8..116 264 53 Plus
Cpr67Fa1-PA 134 CG7941-PA 6..117 8..116 264 53 Plus
Cpr67Fb-PA 122 CG18348-PA 1..116 1..118 261 47.5 Plus
Cpr65Ec-PA 127 CG8634-PA 1..118 1..118 260 48.3 Plus
Cpr65Eb-PA 179 CG8638-PA 1..123 1..118 255 53.6 Plus
Cpr49Ae-PA 134 CG8505-PA 1..130 1..117 250 44.7 Plus
Cpr78Cb-PB 140 CG7663-PB 37..128 24..115 246 55.4 Plus
Cpr78Cb-PA 140 CG7663-PA 37..128 24..115 246 55.4 Plus
Cpr78Ca-PA 127 CG11310-PA 39..118 35..117 237 50.6 Plus
Cpr65Az-PA 239 CG12330-PA 124..211 37..114 236 54.5 Plus
Cpr65Ea-PA 127 CG8640-PA 1..112 1..116 228 46.2 Plus
Cpr47Eg-PA 117 CG9070-PA 9..115 7..117 225 44.4 Plus
Lcp4-PB 112 CG2044-PB 1..109 1..116 222 45.8 Plus
Lcp4-PA 112 CG2044-PA 1..109 1..116 222 45.8 Plus
Lcp2-PB 126 CG8697-PB 1..120 1..119 220 40.8 Plus
Lcp2-PA 126 CG8697-PA 1..120 1..119 220 40.8 Plus
Lcp1-PB 130 CG11650-PB 1..124 1..119 219 39.1 Plus
Lcp1-PA 130 CG11650-PA 1..124 1..119 219 39.1 Plus
Cpr47Ef-PD 601 CG13214-PD 140..225 33..109 219 50 Plus
Cpr47Ef-PC 612 CG13214-PC 140..225 33..109 219 50 Plus
Lcp3-PB 112 CG2043-PB 1..109 1..116 208 43.2 Plus
Lcp3-PA 112 CG2043-PA 1..109 1..116 208 43.2 Plus
Pcp-PA 184 CG3440-PA 40..119 37..118 208 52.4 Plus
Cpr47Ea-PA 135 CG9079-PA 13..127 4..104 199 39 Plus
Cpr49Af-PB 126 CG8510-PB 4..118 6..116 186 35.8 Plus
Cpr49Af-PA 126 CG8510-PA 4..118 6..116 186 35.8 Plus
Cpr49Ag-PA 134 CG8511-PA 1..133 1..99 174 34.8 Plus
Cpr49Ah-PA 190 CG8515-PA 63..148 39..114 174 44.2 Plus
Cpr11B-PB 195 CG2555-PB 72..155 28..104 172 41.2 Plus
Cpr11B-PA 197 CG2555-PA 72..155 28..104 172 41.2 Plus
Cpr65Av-PA 111 CG32405-PA 9..109 4..96 170 37.3 Plus
Cpr65Ax2-PB 102 CG18777-PB 33..100 41..99 165 52.9 Plus
Cpr65Ax2-PA 102 CG18777-PA 33..100 41..99 165 52.9 Plus
Cpr65Ax1-PA 102 CG34270-PA 33..100 41..99 165 52.9 Plus
Cpr49Ab-PA 259 CG30042-PA 160..254 26..115 165 36.7 Plus
Cpr65Aw-PA 117 CG32404-PA 4..104 6..96 160 39.2 Plus
Cpr100A-PA 241 CG12045-PA 1..119 1..119 155 34.7 Plus
Lcp65Aa-PA 102 CG7287-PA 9..100 7..96 153 40.4 Plus
Lcp65Af-PA 100 CG10533-PA 26..100 32..101 151 39.2 Plus
Lcp65Ag2-PA 105 CG10534-PA 4..103 6..99 151 36.5 Plus
Lcp65Ag1-PA 105 CG10530-PA 4..103 6..99 151 36.5 Plus
Lcp65Ag3-PA 105 CG18779-PA 4..103 6..99 148 35.6 Plus
Cpr47Ee-PA 369 CG13222-PA 112..188 34..99 148 37.7 Plus
Acp65Aa-PA 105 CG10297-PA 1..104 1..96 143 36.8 Plus
Lcp65Ad-PB 108 CG6955-PB 11..104 7..96 143 39.6 Plus
Lcp65Ad-PA 108 CG6955-PA 11..104 7..96 143 39.6 Plus
Lcp65Ac-PA 109 CG6956-PA 8..106 8..99 141 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12010-PA 117 GI12010-PA 1..117 1..118 430 68.6 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..114 1..117 365 60.7 Plus
Dmoj\GI12994-PA 134 GI12994-PA 1..113 1..116 282 55.1 Plus
Dmoj\GI19544-PA 132 GI19544-PA 5..116 6..118 275 48.2 Plus
Dmoj\GI20904-PA 119 GI20904-PA 1..117 1..119 264 47.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24679-PA 120 GL24679-PA 1..117 1..117 444 71.8 Plus
Dper\GL24678-PA 119 GL24678-PA 1..116 1..116 435 70.7 Plus
Dper\GL24590-PA 121 GL24590-PA 1..114 1..117 356 58.1 Plus
Dper\GL11748-PA 122 GL11748-PA 1..114 1..116 244 46.2 Plus
Dper\GL25976-PA 192 GL25976-PA 43..122 37..118 236 58.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20507-PA 120 GA20507-PA 1..117 1..117 442 71.8 Plus
Dpse\GA23947-PA 119 GA23947-PA 1..116 1..116 435 70.7 Plus
Dpse\GA20516-PA 121 GA20516-PA 1..114 1..117 360 59 Plus
Dpse\GA21228-PA 183 GA21228-PA 17..125 9..116 266 55.9 Plus
Dpse\GA23698-PA 190 GA23698-PA 17..125 9..116 266 55.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22355-PA 120 GM22355-PA 1..119 1..119 517 95 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..116 1..119 367 60.5 Plus
Dsec\GM25234-PA 122 GM25234-PA 1..116 1..118 258 47.5 Plus
Dsec\GM13790-PA 179 GM13790-PA 1..121 1..116 258 54.5 Plus
Dsec\GM22353-PA 140 GM22353-PA 36..128 23..115 250 54.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14949-PA 120 GD14949-PA 1..119 1..119 517 95 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..116 1..119 367 60.5 Plus
Dsim\GD13091-PA 179 GD13091-PA 1..121 1..116 257 54.5 Plus
Dsim\GD14947-PA 140 GD14947-PA 36..128 23..115 250 54.8 Plus
Dsim\GD14266-PA 116 GD14266-PA 2..116 4..115 244 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13281-PA 119 GJ13281-PA 1..116 1..117 372 60.7 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..114 1..117 364 61.5 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 22..137 1..118 279 46.2 Plus
Dvir\GJ12238-PA 160 GJ12238-PA 1..121 1..116 266 52 Plus
Dvir\GJ13137-PA 139 GJ13137-PA 1..114 1..116 263 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20466-PA 121 GK20466-PA 2..119 1..118 424 70.3 Plus
Dwil\GK20425-PA 121 GK20425-PA 1..116 1..119 352 58 Plus
Dwil\GK17540-PA 191 GK17540-PA 1..122 1..116 279 53.2 Plus
Dwil\GK21874-PA 192 GK21874-PA 73..181 4..118 253 44.8 Plus
Dwil\GK20465-PA 130 GK20465-PA 27..119 23..115 250 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19741-PA 119 GE19741-PA 1..118 1..118 501 89.8 Plus
Dyak\GE23051-PA 119 GE23051-PA 1..118 1..118 496 89 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..116 1..119 363 60.5 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..115 8..119 354 61.6 Plus
Dyak\GE21770-PA 122 GE21770-PA 1..114 1..116 272 49.2 Plus