Clone RE32166 Report

Search the DGRC for RE32166

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:321
Well:66
Vector:pFlc-1
Associated Gene/TranscriptBug22-RA
Protein status:RE32166.pep: gold
Preliminary Size:772
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5343 2002-01-01 Sim4 clustering to Release 2
CG5343 2002-02-22 Blastp of sequenced clone
CG5343 2003-01-01 Sim4 clustering to Release 3
CG5343 2008-04-29 Release 5.5 accounting
CG5343 2008-08-15 Release 5.9 accounting
CG5343 2008-12-18 5.12 accounting

Clone Sequence Records

RE32166.complete Sequence

955 bp (955 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084152

> RE32166.complete
ATTGTTATGGCAACAACAGGATGCCGTGCTAAACAAACTCATTGACATGA
GAAAATAATCAAGTTCCGCATTGATGTTCGTAGTTTGTACGAGTTTCGGC
TGTGCGAAAAATTTACGGCCAACCTTAACTGGCCCTATATAAATTTCGAA
GAGACTATACTCTCCGTGGGGCGAACCGGTCACTGCACAGCAGTCGCGAA
ATGTTCAAAAACACTTTCCAATCGGGATTCCTATCAATTCTGTACAGTAT
TGGCTCAAAGCCACTGCAGCTGTGGGATAAGAAGGTGCGCAATGGACACA
TCAAGCGGATCACCGACAACGACATACAAAGCCTCGTGTTGGAAATAGTC
GGCACCAATGTCAGCACCACGTTCATAACATGTCCGGCAGATCCGAAGAA
GACGCTGGGCATCAAGCTGCCCTTCCTGGTGATGATCATCAAGAACATGA
AGAAGTACTTCACCTTCGAGGTTCAGGTTCTCGATGACAAGAACGTGCGG
CGAAGGTTTAGGGCCAGTAACTACCAGTCGACAACTCGTGTCAAGCCTTT
CATTTGCACCATGCCCATGCGATTGGACGAGGGATGGAACCAGATCCAGT
TCAACCTGTCCGACTTCACGCGTCGCGCATACGGCACCAATTATGTGGAG
ACACTCCGTGTACAGATTCATGCAAATTGCCGCATCAGACGCGTCTACTT
CTCCGATCGTCTCTACTCGGAGGACGAGCTGCCGCCGGAGTTTAAGCTCT
TCCTTCCCATTCAGAAGCCGGTGCAGAAGTCCAATGCGATTTGTAGCTAA
ATTCTGTATGCATCATCAATCAATTAGAGCACCTAACCAGACGGAGTCGA
CGATTAAAACGGCACAAAATGCACAAGACTGCCATCCAGCACTCATTCAA
CACTTTATGGGAATCACGAATAAAAATTGCATCATGTACAAAAAAAAAAA
AAAAA

RE32166.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5343-RA 1064 CG5343-RA 108..1052 1..945 4710 99.8 Plus
CG5188-RA 1135 CG5188-RA 1029..1135 945..839 520 99 Minus
CG17118-RA 987 CG17118-RA 425..496 581..652 225 87.5 Plus
CG17118-RA 987 CG17118-RA 248..324 404..480 175 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10429271..10429748 478..1 2375 99.8 Minus
chr2L 23010047 chr2L 10428754..10429220 939..473 2335 100 Minus
chr2L 23010047 chr2L 10729571..10729642 581..652 225 87.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10430437..10430914 478..1 2390 100 Minus
2L 23513712 2L 10429914..10430386 945..473 2350 99.8 Minus
2L 23513712 2L 10730802..10730873 581..652 225 87.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10430437..10430914 478..1 2390 100 Minus
2L 23513712 2L 10429914..10430386 945..473 2350 99.7 Minus
2L 23513712 2L 10730802..10730873 581..652 225 87.5 Plus
2L 23513712 2L 10730559..10730633 404..478 180 82.6 Plus
Blast to na_te.dros performed on 2019-03-16 19:05:29 has no hits.

RE32166.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:06:13 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10428754..10429216 477..939 100 <- Minus
chr2L 10429273..10429748 1..476 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:38 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..600 201..800 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:38:40 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..600 201..800 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:55 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..600 201..800 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:57 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..600 201..800 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:35 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
Bug22-RA 1..600 201..800 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:45 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:38:40 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:55 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 5..943 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:57 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
CG5343-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:35 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
Bug22-RA 5..943 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:13 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10429920..10430382 477..939 100 <- Minus
2L 10430439..10430914 1..476 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:13 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10429920..10430382 477..939 100 <- Minus
2L 10430439..10430914 1..476 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:13 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10429920..10430382 477..939 100 <- Minus
2L 10430439..10430914 1..476 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:55 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10429920..10430382 477..939 100 <- Minus
arm_2L 10430439..10430914 1..476 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:06 Download gff for RE32166.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10429920..10430382 477..939 100 <- Minus
2L 10430439..10430914 1..476 100   Minus

RE32166.pep Sequence

Translation from 200 to 799

> RE32166.pep
MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIV
GTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVR
RRFRASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVE
TLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQKSNAICS*

RE32166.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14097-PA 199 GF14097-PA 1..199 1..199 1061 100 Plus
Dana\GF15822-PA 272 GF15822-PA 1..183 1..183 674 63.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23930-PA 199 GG23930-PA 1..199 1..199 1061 100 Plus
Dere\GG23671-PA 277 GG23671-PA 1..184 1..184 669 62.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13299-PA 199 GH13299-PA 1..199 1..199 1061 100 Plus
Dgri\GH10426-PA 269 GH10426-PA 1..184 1..184 671 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Bug22-PA 199 CG5343-PA 1..199 1..199 1042 100 Plus
CG17118-PA 281 CG17118-PA 1..183 1..183 642 62.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18163-PA 199 GI18163-PA 1..199 1..199 1061 100 Plus
Dmoj\GI23484-PA 271 GI23484-PA 1..184 1..184 675 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18997-PA 199 GL18997-PA 1..199 1..199 1024 97 Plus
Dper\GL26630-PA 274 GL26630-PA 1..184 1..184 680 64.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14331-PA 274 GA14331-PA 1..184 1..184 680 64.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11664-PA 199 GM11664-PA 1..199 1..199 1061 100 Plus
Dsec\GM18720-PA 281 GM18720-PA 1..184 1..184 664 62.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22257-PA 199 GD22257-PA 1..199 1..199 1061 100 Plus
Dsim\GD23728-PA 232 GD23728-PA 1..135 50..184 501 64.4 Plus
Dsim\GD11616-PA 246 GD11616-PA 1..192 1..191 501 50.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14593-PA 199 GJ14593-PA 1..199 1..199 1055 99.5 Plus
Dvir\GJ20690-PA 273 GJ20690-PA 1..184 1..184 678 64.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15261-PA 199 GK15261-PA 1..199 1..199 1061 100 Plus
Dwil\GK14668-PA 286 GK14668-PA 1..184 1..184 672 62.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25932-PA 199 GE25932-PA 1..199 1..199 1061 100 Plus
Dyak\GE18484-PA 277 GE18484-PA 1..184 1..184 667 62.5 Plus

RE32166.hyp Sequence

Translation from 200 to 799

> RE32166.hyp
MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIV
GTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVR
RRFRASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVE
TLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQKSNAICS*

RE32166.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
Bug22-PA 199 CG5343-PA 1..199 1..199 1042 100 Plus
CG17118-PA 281 CG17118-PA 1..183 1..183 642 62.8 Plus