RE32413.complete Sequence
522 bp (522 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113449
> RE32413.complete
ATTGAGTACCAATCCAGCGAACATCCATCAATCAGCGGCCTTTAATCTGT
TTGAATCCCTTCGAGACGTACAAAAATGAAGTTCCTTGCCCTGAGTCTCG
CCCTGATCGCCGTGATCTCCTGCTCTCTGGCCATACCTGTGGATTTCGAA
AATGGAGAACCACTGACACTCTTGGAATTGGAGGCGGAACAGGAGCCACA
AGTTGATGAACTGGAGGGCGAGAGAGTGGTTCGAGGACTGGGAGGACTTG
GAGGACTTGGCGGCAAGTTCGGCGGCTTTGGAGGACTCGGCGGCTTGAAG
GGAGGATTCGGTGGTCTTGGTCACGGCTTTGGCGGTGGTTTTGGAGGACA
CGGTTTCGGCGGCGGCTTCGGTGGACTTGGCAGCTTCAAGAGCCTATTCG
GCAAGAAGTTCCGCTAAAGCAACAGCACTCACCCAAAATATAGTCTAAGA
GTTTCGTAATAAAGCTTAGTTAAGTAACATTAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
RE32413.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:26:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13217-RA | 481 | CG13217-RA | 1..481 | 1..481 | 2390 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:55:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7123669..7124149 | 481..1 | 2330 | 99 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:55:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11236199..11236683 | 485..1 | 2410 | 99.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11237398..11237882 | 485..1 | 2410 | 99.7 | Minus |
Blast to na_te.dros performed 2019-03-16 01:55:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Stalker2 | 7672 | Stalker2 STALKER2 7672bp | 2879..2986 | 397..296 | 112 | 59.3 | Minus |
RE32413.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:56:15 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7123669..7124149 | 1..481 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:45 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..342 | 76..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:19 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..342 | 76..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..342 | 76..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:11 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..342 | 76..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:45 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..342 | 76..417 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:01 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..481 | 1..481 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:19 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..481 | 1..481 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 4..484 | 1..481 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:12 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 1..481 | 1..481 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:45 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13217-RA | 4..484 | 1..481 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11236203..11236683 | 1..481 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11236203..11236683 | 1..481 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11236203..11236683 | 1..481 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:28 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7123708..7124188 | 1..481 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:20 Download gff for
RE32413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11237402..11237882 | 1..481 | 99 | | Minus |
RE32413.hyp Sequence
Translation from 75 to 416
> RE32413.hyp
MKFLALSLALIAVISCSLAIPVDFENGEPLTLLELEAEQEPQVDELEGER
VVRGLGGLGGLGGKFGGFGGLGGLKGGFGGLGHGFGGGFGGHGFGGGFGG
LGSFKSLFGKKFR*
RE32413.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:10:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13217-PA | 113 | CG13217-PA | 1..113 | 1..113 | 594 | 100 | Plus |
Listericin-PA | 121 | CG9080-PA | 3..95 | 2..100 | 157 | 43 | Plus |
CG34227-PA | 104 | CG34227-PA | 1..99 | 1..100 | 151 | 38.2 | Plus |
CG17738-PA | 110 | CG17738-PA | 4..106 | 5..100 | 147 | 38.5 | Plus |
CG8157-PB | 113 | CG8157-PB | 49..94 | 54..100 | 147 | 63.8 | Plus |
RE32413.pep Sequence
Translation from 75 to 416
> RE32413.pep
MKFLALSLALIAVISCSLAIPVDFENGEPLTLLELEAEQEPQVDELEGER
VVRGLGGLGGLGGKFGGFGGLGGLKGGFGGLGHGFGGGFGGHGFGGGFGG
LGSFKSLFGKKFR*
RE32413.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:32:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12433-PA | 111 | GF12433-PA | 1..64 | 1..61 | 184 | 76.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:32:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22694-PA | 113 | GG22694-PA | 1..113 | 1..113 | 494 | 97.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13217-PA | 113 | CG13217-PA | 1..113 | 1..113 | 594 | 100 | Plus |
Listericin-PA | 121 | CG9080-PA | 3..95 | 2..100 | 157 | 43 | Plus |
CG34227-PA | 104 | CG34227-PA | 1..99 | 1..100 | 151 | 38.2 | Plus |
CG17738-PA | 110 | CG17738-PA | 4..106 | 5..100 | 147 | 38.5 | Plus |
CG8157-PB | 113 | CG8157-PB | 49..94 | 54..100 | 147 | 63.8 | Plus |
CG8157-PA | 113 | CG8157-PA | 49..94 | 54..100 | 147 | 63.8 | Plus |
Pex13-PA | 440 | CG4663-PA | 83..131 | 54..100 | 146 | 58 | Plus |
CG8157-PB | 113 | CG8157-PB | 21..68 | 54..100 | 145 | 65.3 | Plus |
CG8157-PA | 113 | CG8157-PA | 21..68 | 54..100 | 145 | 65.3 | Plus |
CG8157-PB | 113 | CG8157-PB | 34..81 | 54..100 | 141 | 63.3 | Plus |
CG8157-PA | 113 | CG8157-PA | 34..81 | 54..100 | 141 | 63.3 | Plus |
CG9757-PB | 127 | CG9757-PB | 4..125 | 3..112 | 141 | 36 | Plus |
CG9757-PB | 127 | CG9757-PB | 79..127 | 56..100 | 141 | 62.7 | Plus |
CG9757-PA | 127 | CG9757-PA | 4..125 | 3..112 | 141 | 36 | Plus |
CG9757-PA | 127 | CG9757-PA | 79..127 | 56..100 | 141 | 62.7 | Plus |
CG9269-PA | 146 | CG9269-PA | 19..90 | 27..107 | 141 | 42 | Plus |
CG10918-PA | 183 | CG10918-PA | 36..88 | 53..104 | 136 | 63.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:32:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20469-PA | 113 | GM20469-PA | 1..113 | 1..113 | 502 | 97.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:32:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25938-PA | 113 | GD25938-PA | 1..113 | 1..113 | 507 | 99.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:32:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13047-PA | 113 | GE13047-PA | 1..113 | 1..113 | 497 | 96.5 | Plus |