Clone RE32413 Report

Search the DGRC for RE32413

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:324
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCG13217-RA
Protein status:RE32413.pep: gold
Preliminary Size:342
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13217 2002-01-01 Sim4 clustering to Release 2
CG13217 2002-04-21 Blastp of sequenced clone
CG13217 2003-01-01 Sim4 clustering to Release 3
CG13217 2008-04-29 Release 5.5 accounting
CG13217 2008-08-15 Release 5.9 accounting
CG13217 2008-12-18 5.12 accounting

Clone Sequence Records

RE32413.complete Sequence

522 bp (522 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113449

> RE32413.complete
ATTGAGTACCAATCCAGCGAACATCCATCAATCAGCGGCCTTTAATCTGT
TTGAATCCCTTCGAGACGTACAAAAATGAAGTTCCTTGCCCTGAGTCTCG
CCCTGATCGCCGTGATCTCCTGCTCTCTGGCCATACCTGTGGATTTCGAA
AATGGAGAACCACTGACACTCTTGGAATTGGAGGCGGAACAGGAGCCACA
AGTTGATGAACTGGAGGGCGAGAGAGTGGTTCGAGGACTGGGAGGACTTG
GAGGACTTGGCGGCAAGTTCGGCGGCTTTGGAGGACTCGGCGGCTTGAAG
GGAGGATTCGGTGGTCTTGGTCACGGCTTTGGCGGTGGTTTTGGAGGACA
CGGTTTCGGCGGCGGCTTCGGTGGACTTGGCAGCTTCAAGAGCCTATTCG
GCAAGAAGTTCCGCTAAAGCAACAGCACTCACCCAAAATATAGTCTAAGA
GTTTCGTAATAAAGCTTAGTTAAGTAACATTAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

RE32413.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13217-RA 481 CG13217-RA 1..481 1..481 2390 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7123669..7124149 481..1 2330 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11236199..11236683 485..1 2410 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11237398..11237882 485..1 2410 99.7 Minus
Blast to na_te.dros performed 2019-03-16 01:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 2879..2986 397..296 112 59.3 Minus

RE32413.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:56:15 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7123669..7124149 1..481 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:45 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..342 76..417 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:19 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..342 76..417 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..342 76..417 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:11 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..342 76..417 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:45 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..342 76..417 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:01 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..481 1..481 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:19 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..481 1..481 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 4..484 1..481 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:12 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 1..481 1..481 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:45 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13217-RA 4..484 1..481 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11236203..11236683 1..481 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11236203..11236683 1..481 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:15 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11236203..11236683 1..481 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:28 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7123708..7124188 1..481 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:20 Download gff for RE32413.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11237402..11237882 1..481 99   Minus

RE32413.hyp Sequence

Translation from 75 to 416

> RE32413.hyp
MKFLALSLALIAVISCSLAIPVDFENGEPLTLLELEAEQEPQVDELEGER
VVRGLGGLGGLGGKFGGFGGLGGLKGGFGGLGHGFGGGFGGHGFGGGFGG
LGSFKSLFGKKFR*

RE32413.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13217-PA 113 CG13217-PA 1..113 1..113 594 100 Plus
Listericin-PA 121 CG9080-PA 3..95 2..100 157 43 Plus
CG34227-PA 104 CG34227-PA 1..99 1..100 151 38.2 Plus
CG17738-PA 110 CG17738-PA 4..106 5..100 147 38.5 Plus
CG8157-PB 113 CG8157-PB 49..94 54..100 147 63.8 Plus

RE32413.pep Sequence

Translation from 75 to 416

> RE32413.pep
MKFLALSLALIAVISCSLAIPVDFENGEPLTLLELEAEQEPQVDELEGER
VVRGLGGLGGLGGKFGGFGGLGGLKGGFGGLGHGFGGGFGGHGFGGGFGG
LGSFKSLFGKKFR*

RE32413.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12433-PA 111 GF12433-PA 1..64 1..61 184 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22694-PA 113 GG22694-PA 1..113 1..113 494 97.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13217-PA 113 CG13217-PA 1..113 1..113 594 100 Plus
Listericin-PA 121 CG9080-PA 3..95 2..100 157 43 Plus
CG34227-PA 104 CG34227-PA 1..99 1..100 151 38.2 Plus
CG17738-PA 110 CG17738-PA 4..106 5..100 147 38.5 Plus
CG8157-PB 113 CG8157-PB 49..94 54..100 147 63.8 Plus
CG8157-PA 113 CG8157-PA 49..94 54..100 147 63.8 Plus
Pex13-PA 440 CG4663-PA 83..131 54..100 146 58 Plus
CG8157-PB 113 CG8157-PB 21..68 54..100 145 65.3 Plus
CG8157-PA 113 CG8157-PA 21..68 54..100 145 65.3 Plus
CG8157-PB 113 CG8157-PB 34..81 54..100 141 63.3 Plus
CG8157-PA 113 CG8157-PA 34..81 54..100 141 63.3 Plus
CG9757-PB 127 CG9757-PB 4..125 3..112 141 36 Plus
CG9757-PB 127 CG9757-PB 79..127 56..100 141 62.7 Plus
CG9757-PA 127 CG9757-PA 4..125 3..112 141 36 Plus
CG9757-PA 127 CG9757-PA 79..127 56..100 141 62.7 Plus
CG9269-PA 146 CG9269-PA 19..90 27..107 141 42 Plus
CG10918-PA 183 CG10918-PA 36..88 53..104 136 63.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20469-PA 113 GM20469-PA 1..113 1..113 502 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25938-PA 113 GD25938-PA 1..113 1..113 507 99.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13047-PA 113 GE13047-PA 1..113 1..113 497 96.5 Plus