Clone RE32705 Report

Search the DGRC for RE32705

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:327
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG5021-RC
Protein status:RE32705.pep: gold
Preliminary Size:763
Sequenced Size:1306

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5021 2001-12-14 Blastp of sequenced clone
CG5021 2002-01-01 Sim4 clustering to Release 2
CG5021 2003-01-01 Sim4 clustering to Release 3
CG5021 2008-04-29 Release 5.5 accounting
CG5021 2008-08-15 Release 5.9 accounting
CG5021 2008-12-18 5.12 accounting

Clone Sequence Records

RE32705.complete Sequence

1306 bp (1306 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071297

> RE32705.complete
AGAAGGCTACGCAGGCAGAAACAACAACAACGTCCCAGGCGAAGAAAATA
TATTAAATCCCCTGAAAAACCACGAAAATCCATGAAAATTGCACCCAACT
AGGAATTAGAAGTCACTCCCTACACCAGCATGGCATCCGCTACGGTAAGA
AATGTGCCGCTGCTCGACGATGACACGATACCCTTTGGCGAGGAGGACGA
GATGCGGGATCCCAGTCGCGCGGGTCAGAAATACACGCACCCGTACGTCA
CCTTCTTCCACCTGTTCTTCAGGGGCGCCGCCATCCTGATCTATATGTTC
TGCGGTTGGTTCAGCGACTCCTTCATCACCAGCTTCGTTTTCGTGGTGCT
CTTCCTGTCCGCCGACTTCTGGACGGTGAAGAACATCTCGGGCAGATTGC
TGGTCGGTCTCCGCTGGTGGAACTACGTCGACGACGATGGCGTATCGCAC
TGGGTGTTTGAGTCAAAGAACTCTGAATCCTACCAGAGTCGGGTCAACAA
GAACGAGCAGCGCATCTTCTGGCTGGGACTCATCCTCTGTCCCGTCTTCT
GGGGCCTCTTCTTCCTGTTCGCCCTATTCGGCCTGAAGTTCAAATGGCTA
CTGCTGGTAATGATCGCCATTGCGCTGAATGCCGCCAATCTGTATGGCTA
CGTCAAGTGTAACTATGGTGCCAATAAGGATCTGAATTCCGCCGCCACAG
ACTTTGTGAAAACGCAGTTCTTCAAGAATGCTGTGGACATCATGACAAGG
CCCAGTGGCGCCCCACCGCCAACAAATGTACGCCCGACGGGAGTCGTTTG
AGCTGGTGGAGACGCCATCTACTAAGTCACCTTGCCACCGTCTGCTGCAG
CGCATTCCAAAGAGTATTCGACGCTTCTTCTGGCGCGGACCACGACCTTC
GATTGGCATCGCTGTCTGTGTACCATATGTAAAACTTAATTTAGCCATAC
TGCAATCTACCATAATCATTTCTTACTTTTACTCGGATTAAAGGACCGCA
TGTGCGTGTGACATGCAACCAGTATGCCACATGGTTTTATTTCGAATGGT
TTAACTACAAATTTAAGAATAGTTATTAAAAGGGATTCAGATATAGCGAA
ATGTGTTTTATTTTTATTCTCTGCATCTTAATCTGAGTACGAAAGACGTG
AAGCAAATAATTTTCATTACTGTTAGATTACTATAAATTATTTAGTTTAT
TTTCTTTTTTGTCATTTTAGTTTCATATATGAAACTGTCGTAAACATATA
TTTAAAAATGAAGCGTAAATATAATCATTCCTGCAAAACTAAAAAAAAAA
AAAAAA

RE32705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5021-RC 1312 CG5021-RC 23..1312 1..1290 6435 99.9 Plus
CG5021-RD 1364 CG5021-RD 228..1364 154..1290 5670 99.9 Plus
CG5021-RA 1358 CG5021-RA 555..1358 487..1290 4005 99.8 Plus
CG5021-RA 1358 CG5021-RA 84..554 1..471 2355 100 Plus
CG5021-RD 1364 CG5021-RD 84..229 1..146 730 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8959629..8960447 472..1290 4065 99.8 Plus
chr3L 24539361 chr3L 8959341..8959579 233..471 1180 99.6 Plus
chr3L 24539361 chr3L 8958903..8959057 1..155 775 100 Plus
chr3L 24539361 chr3L 8959191..8959274 154..237 420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8967566..8968387 472..1293 4095 99.9 Plus
3L 28110227 3L 8967278..8967516 233..471 1180 99.6 Plus
3L 28110227 3L 8966840..8966994 1..155 775 100 Plus
3L 28110227 3L 8967128..8967211 154..237 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8960666..8961487 472..1293 4095 99.8 Plus
3L 28103327 3L 8960378..8960616 233..471 1180 99.5 Plus
3L 28103327 3L 8959940..8960094 1..155 775 100 Plus
3L 28103327 3L 8960228..8960311 154..237 420 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:52:49 has no hits.

RE32705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:53:52 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8959191..8959273 154..236 100 -> Plus
chr3L 8959345..8959579 237..471 100 -> Plus
chr3L 8959629..8960447 472..1290 99   Plus
chr3L 8958903..8959055 1..153 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:54 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RA 1..342 130..471 100 == Plus
CG5021-RA 343..657 487..801 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:18 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 1..672 130..801 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:17:18 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 1..672 130..801 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:51 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RA 1..342 130..471 100 == Plus
CG5021-RA 343..657 487..801 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:44:37 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 1..672 130..801 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:39 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 1..462 1..471 98 == Plus
CG5021-RB 463..1266 487..1290 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:18 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 1..1290 1..1290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:17:18 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 12..1088 1..1077 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:51 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 1..462 1..471 98 == Plus
CG5021-RB 463..1266 487..1290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:44:37 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RC 12..1088 1..1077 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:52 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967566..8968384 472..1290 99   Plus
3L 8966840..8966992 1..153 100 -> Plus
3L 8967128..8967210 154..236 100 -> Plus
3L 8967282..8967516 237..471 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:52 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967566..8968384 472..1290 99   Plus
3L 8966840..8966992 1..153 100 -> Plus
3L 8967128..8967210 154..236 100 -> Plus
3L 8967282..8967516 237..471 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:52 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967566..8968384 472..1290 99   Plus
3L 8966840..8966992 1..153 100 -> Plus
3L 8967128..8967210 154..236 100 -> Plus
3L 8967282..8967516 237..471 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:17:18 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8959940..8960092 1..153 100 -> Plus
arm_3L 8960228..8960310 154..236 100 -> Plus
arm_3L 8960382..8960616 237..471 100 -> Plus
arm_3L 8960666..8961484 472..1290 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:14 Download gff for RE32705.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8960382..8960616 237..471 100 -> Plus
3L 8960666..8961484 472..1290 99   Plus
3L 8959940..8960092 1..153 100 -> Plus
3L 8960228..8960310 154..236 100 -> Plus

RE32705.pep Sequence

Translation from 129 to 800

> RE32705.pep
MASATVRNVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGA
AILIYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYV
DDDGVSHWVFESKNSESYQSRVNKNEQRIFWLGLILCPVFWGLFFLFALF
GLKFKWLLLVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKN
AVDIMTRPSGAPPPTNVRPTGVV*

RE32705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24367-PA 215 GF24367-PA 1..215 1..223 1043 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14361-PA 215 GG14361-PA 1..215 1..223 1092 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16045-PA 216 GH16045-PA 1..216 1..223 1030 88.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5021-PC 223 CG5021-PC 1..223 1..223 1201 100 Plus
CG5021-PD 220 CG5021-PD 1..220 1..223 1172 98.7 Plus
CG5021-PA 218 CG5021-PA 1..218 1..223 1160 97.8 Plus
CG5021-PB 215 CG5021-PB 1..215 1..223 1131 96.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12310-PA 215 GI12310-PA 1..215 1..223 1031 87.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12488-PA 215 GL12488-PA 1..215 1..223 1059 90.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18600-PA 215 GA18600-PA 1..215 1..223 1059 90.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25106-PA 220 GM25106-PA 1..220 1..223 1130 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14141-PA 232 GD14141-PA 1..232 1..223 1127 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13246-PA 220 GJ13246-PA 1..220 1..223 1007 92.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16690-PA 216 GK16690-PA 1..216 1..223 998 86.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20793-PA 215 GE20793-PA 1..215 1..223 1086 94.2 Plus

RE32705.hyp Sequence

Translation from 129 to 800

> RE32705.hyp
MASATVRNVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGA
AILIYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYV
DDDGVSHWVFESKNSESYQSRVNKNEQRIFWLGLILCPVFWGLFFLFALF
GLKFKWLLLVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKN
AVDIMTRPSGAPPPTNVRPTGVV*

RE32705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5021-PC 223 CG5021-PC 1..223 1..223 1201 100 Plus
CG5021-PD 220 CG5021-PD 1..220 1..223 1172 98.7 Plus
CG5021-PA 218 CG5021-PA 1..218 1..223 1160 97.8 Plus
CG5021-PB 215 CG5021-PB 1..215 1..223 1131 96.4 Plus