BDGP Sequence Production Resources |
Search the DGRC for RE32705
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 327 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG5021-RC |
Protein status: | RE32705.pep: gold |
Preliminary Size: | 763 |
Sequenced Size: | 1306 |
Gene | Date | Evidence |
---|---|---|
CG5021 | 2001-12-14 | Blastp of sequenced clone |
CG5021 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5021 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5021 | 2008-04-29 | Release 5.5 accounting |
CG5021 | 2008-08-15 | Release 5.9 accounting |
CG5021 | 2008-12-18 | 5.12 accounting |
1306 bp (1306 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071297
> RE32705.complete AGAAGGCTACGCAGGCAGAAACAACAACAACGTCCCAGGCGAAGAAAATA TATTAAATCCCCTGAAAAACCACGAAAATCCATGAAAATTGCACCCAACT AGGAATTAGAAGTCACTCCCTACACCAGCATGGCATCCGCTACGGTAAGA AATGTGCCGCTGCTCGACGATGACACGATACCCTTTGGCGAGGAGGACGA GATGCGGGATCCCAGTCGCGCGGGTCAGAAATACACGCACCCGTACGTCA CCTTCTTCCACCTGTTCTTCAGGGGCGCCGCCATCCTGATCTATATGTTC TGCGGTTGGTTCAGCGACTCCTTCATCACCAGCTTCGTTTTCGTGGTGCT CTTCCTGTCCGCCGACTTCTGGACGGTGAAGAACATCTCGGGCAGATTGC TGGTCGGTCTCCGCTGGTGGAACTACGTCGACGACGATGGCGTATCGCAC TGGGTGTTTGAGTCAAAGAACTCTGAATCCTACCAGAGTCGGGTCAACAA GAACGAGCAGCGCATCTTCTGGCTGGGACTCATCCTCTGTCCCGTCTTCT GGGGCCTCTTCTTCCTGTTCGCCCTATTCGGCCTGAAGTTCAAATGGCTA CTGCTGGTAATGATCGCCATTGCGCTGAATGCCGCCAATCTGTATGGCTA CGTCAAGTGTAACTATGGTGCCAATAAGGATCTGAATTCCGCCGCCACAG ACTTTGTGAAAACGCAGTTCTTCAAGAATGCTGTGGACATCATGACAAGG CCCAGTGGCGCCCCACCGCCAACAAATGTACGCCCGACGGGAGTCGTTTG AGCTGGTGGAGACGCCATCTACTAAGTCACCTTGCCACCGTCTGCTGCAG CGCATTCCAAAGAGTATTCGACGCTTCTTCTGGCGCGGACCACGACCTTC GATTGGCATCGCTGTCTGTGTACCATATGTAAAACTTAATTTAGCCATAC TGCAATCTACCATAATCATTTCTTACTTTTACTCGGATTAAAGGACCGCA TGTGCGTGTGACATGCAACCAGTATGCCACATGGTTTTATTTCGAATGGT TTAACTACAAATTTAAGAATAGTTATTAAAAGGGATTCAGATATAGCGAA ATGTGTTTTATTTTTATTCTCTGCATCTTAATCTGAGTACGAAAGACGTG AAGCAAATAATTTTCATTACTGTTAGATTACTATAAATTATTTAGTTTAT TTTCTTTTTTGTCATTTTAGTTTCATATATGAAACTGTCGTAAACATATA TTTAAAAATGAAGCGTAAATATAATCATTCCTGCAAAACTAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5021-RC | 1312 | CG5021-RC | 23..1312 | 1..1290 | 6435 | 99.9 | Plus |
CG5021-RD | 1364 | CG5021-RD | 228..1364 | 154..1290 | 5670 | 99.9 | Plus |
CG5021-RA | 1358 | CG5021-RA | 555..1358 | 487..1290 | 4005 | 99.8 | Plus |
CG5021-RA | 1358 | CG5021-RA | 84..554 | 1..471 | 2355 | 100 | Plus |
CG5021-RD | 1364 | CG5021-RD | 84..229 | 1..146 | 730 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8959629..8960447 | 472..1290 | 4065 | 99.8 | Plus |
chr3L | 24539361 | chr3L | 8959341..8959579 | 233..471 | 1180 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 8958903..8959057 | 1..155 | 775 | 100 | Plus |
chr3L | 24539361 | chr3L | 8959191..8959274 | 154..237 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8967566..8968387 | 472..1293 | 4095 | 99.9 | Plus |
3L | 28110227 | 3L | 8967278..8967516 | 233..471 | 1180 | 99.6 | Plus |
3L | 28110227 | 3L | 8966840..8966994 | 1..155 | 775 | 100 | Plus |
3L | 28110227 | 3L | 8967128..8967211 | 154..237 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8960666..8961487 | 472..1293 | 4095 | 99.8 | Plus |
3L | 28103327 | 3L | 8960378..8960616 | 233..471 | 1180 | 99.5 | Plus |
3L | 28103327 | 3L | 8959940..8960094 | 1..155 | 775 | 100 | Plus |
3L | 28103327 | 3L | 8960228..8960311 | 154..237 | 420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8959191..8959273 | 154..236 | 100 | -> | Plus |
chr3L | 8959345..8959579 | 237..471 | 100 | -> | Plus |
chr3L | 8959629..8960447 | 472..1290 | 99 | Plus | |
chr3L | 8958903..8959055 | 1..153 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RA | 1..342 | 130..471 | 100 | == | Plus |
CG5021-RA | 343..657 | 487..801 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 1..672 | 130..801 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 1..672 | 130..801 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RA | 1..342 | 130..471 | 100 | == | Plus |
CG5021-RA | 343..657 | 487..801 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 1..672 | 130..801 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 1..462 | 1..471 | 98 | == | Plus |
CG5021-RB | 463..1266 | 487..1290 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 1..1290 | 1..1290 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 12..1088 | 1..1077 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 1..462 | 1..471 | 98 | == | Plus |
CG5021-RB | 463..1266 | 487..1290 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RC | 12..1088 | 1..1077 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967566..8968384 | 472..1290 | 99 | Plus | |
3L | 8966840..8966992 | 1..153 | 100 | -> | Plus |
3L | 8967128..8967210 | 154..236 | 100 | -> | Plus |
3L | 8967282..8967516 | 237..471 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967566..8968384 | 472..1290 | 99 | Plus | |
3L | 8966840..8966992 | 1..153 | 100 | -> | Plus |
3L | 8967128..8967210 | 154..236 | 100 | -> | Plus |
3L | 8967282..8967516 | 237..471 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967566..8968384 | 472..1290 | 99 | Plus | |
3L | 8966840..8966992 | 1..153 | 100 | -> | Plus |
3L | 8967128..8967210 | 154..236 | 100 | -> | Plus |
3L | 8967282..8967516 | 237..471 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8959940..8960092 | 1..153 | 100 | -> | Plus |
arm_3L | 8960228..8960310 | 154..236 | 100 | -> | Plus |
arm_3L | 8960382..8960616 | 237..471 | 100 | -> | Plus |
arm_3L | 8960666..8961484 | 472..1290 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8960382..8960616 | 237..471 | 100 | -> | Plus |
3L | 8960666..8961484 | 472..1290 | 99 | Plus | |
3L | 8959940..8960092 | 1..153 | 100 | -> | Plus |
3L | 8960228..8960310 | 154..236 | 100 | -> | Plus |
Translation from 129 to 800
> RE32705.pep MASATVRNVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGA AILIYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYV DDDGVSHWVFESKNSESYQSRVNKNEQRIFWLGLILCPVFWGLFFLFALF GLKFKWLLLVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKN AVDIMTRPSGAPPPTNVRPTGVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24367-PA | 215 | GF24367-PA | 1..215 | 1..223 | 1043 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14361-PA | 215 | GG14361-PA | 1..215 | 1..223 | 1092 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16045-PA | 216 | GH16045-PA | 1..216 | 1..223 | 1030 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5021-PC | 223 | CG5021-PC | 1..223 | 1..223 | 1201 | 100 | Plus |
CG5021-PD | 220 | CG5021-PD | 1..220 | 1..223 | 1172 | 98.7 | Plus |
CG5021-PA | 218 | CG5021-PA | 1..218 | 1..223 | 1160 | 97.8 | Plus |
CG5021-PB | 215 | CG5021-PB | 1..215 | 1..223 | 1131 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12310-PA | 215 | GI12310-PA | 1..215 | 1..223 | 1031 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12488-PA | 215 | GL12488-PA | 1..215 | 1..223 | 1059 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18600-PA | 215 | GA18600-PA | 1..215 | 1..223 | 1059 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25106-PA | 220 | GM25106-PA | 1..220 | 1..223 | 1130 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14141-PA | 232 | GD14141-PA | 1..232 | 1..223 | 1127 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13246-PA | 220 | GJ13246-PA | 1..220 | 1..223 | 1007 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16690-PA | 216 | GK16690-PA | 1..216 | 1..223 | 998 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20793-PA | 215 | GE20793-PA | 1..215 | 1..223 | 1086 | 94.2 | Plus |
Translation from 129 to 800
> RE32705.hyp MASATVRNVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGA AILIYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYV DDDGVSHWVFESKNSESYQSRVNKNEQRIFWLGLILCPVFWGLFFLFALF GLKFKWLLLVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKN AVDIMTRPSGAPPPTNVRPTGVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5021-PC | 223 | CG5021-PC | 1..223 | 1..223 | 1201 | 100 | Plus |
CG5021-PD | 220 | CG5021-PD | 1..220 | 1..223 | 1172 | 98.7 | Plus |
CG5021-PA | 218 | CG5021-PA | 1..218 | 1..223 | 1160 | 97.8 | Plus |
CG5021-PB | 215 | CG5021-PB | 1..215 | 1..223 | 1131 | 96.4 | Plus |