Clone RE32823 Report

Search the DGRC for RE32823

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:328
Well:23
Vector:pFlc-1
Associated Gene/TranscriptEf1gamma-RA
Protein status:RE32823.pep: gold
Preliminary Size:1721
Sequenced Size:1731

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11901 2002-10-12 Blastp of sequenced clone
CG11901 2003-01-01 Sim4 clustering to Release 3
Ef1gamma 2008-04-29 Release 5.5 accounting
Ef1gamma 2008-08-15 Release 5.9 accounting
Ef1gamma 2008-12-18 5.12 accounting

Clone Sequence Records

RE32823.complete Sequence

1731 bp (1731 high quality bases) assembled on 2002-10-12

GenBank Submission: BT001612

> RE32823.complete
GGGTGCTCCGCGTTTTTTCGCTGAATTTGCCACTATATCGTATTTAATAC
TGTATTTGCAGGCAGACGATTTAAACGGCGAATCCACCATGGTGAAAGGA
ACTCTGTACACTTACCCCGAGAACTTCCGGGCCTACAAGGCGCTCATCGC
AGCCCAGTACTCCGGAGCCCAGGTGAAAGTGGCCGACAACTTCAAGTTCG
GCGAGACCAACAAGTCGGCTGAGTTCCTCAAGAAGTTCCCCGGTGGCAAG
GTACCCGCCTTTGAGACCGCCGAAGGACAGTACTTGAGCGAGTCCAATGC
CATCGCCTACCTGCTGGCCAACGAGCAGCTGCGCGGCGGAAAGTGCCCCT
TCGTGCAGGCCCAGGTCCAGCAGTGGATCTCCTTCGCCGACAACGAGATT
GTGCCTGCCTCCTGTGCCTGGGTCTTCCCCCTGCTGGGCATTCTGCCGCA
GCAGAAGAACAGCACTGCCAAGCAAGAGGCCGAGGCTGTGCTGCAGCAGC
TCAACCAGAAGCTGCAGGACGCCACCTTCCTGGCCGGCGAGAGGATCACA
TTGGCCGACATTGTGGTCTTCAGCAGTCTGCTCCACCTGTACGAGTACGT
CCTGGAGCCCAGTGTGCGCAGTGCCTTCGGCAACGTGAACCGCTGGTTCG
TCACCATCCTCAACCAGAAGCAGGTCCAGGCCGTCGTCAAGGACTACAAG
CTGTGCGAGAAGGCCCTGGTCTTCGACCCCAAGAAGTACGCCGAGTTCCA
GGCCAAGACCGGAGCCGCCAAGCCCCAGCAGCAGGCTCAGCAGCAGAAGC
AGGAGAAGAAGCCCAAGGAAAAGAAGGAGGCGCCCAAGAAGGCTGCCGAG
CCCGCCGAGGAGTTGGACGCCGCCGATGAGGCCCTGGCCGCCGAGCCCAA
GTCCAAGGACCCCTTCGATGCGCTGCCCAAGGGCACCTTCAACTTCGATG
ACTTCAAGCGCGTGTACTCCAACGAGGACGAGGCCAAGTCCATTCCCTAC
TTCTTCGATAAGTTCGATGCCGAGAACTACTCGATCTGGTTTGGCGAGTA
CAAATACAACGAGGAGCTGTCCAAGGTGTTCATGTCGTGCAATCTCATCA
CCGGCATGTTCCAGCGTCTGGACAAGATGCGCAAGGCGGCCTTCGCCTCC
GTTTGCCTGTTCGGCGAGGACGGCAACAGCACCATCTCCGGTATCTGGGT
GTGGCGCGGACAGGATCTGGCCTTCACGCTCTCCCCCGACTGGCAGATCG
ACTACGAGGTCTACGACTGGAAGAAGCTCGACGCCAAGAGCGAGGAGACC
AAGAAGCTGGTCACCCAGTACTTCTCCTGGTCCGGCACCGACAAGGACGG
TCGCAAGTTCAACCAGGGCAAGATCTTCAAGTAATCATCTCTGCCTAGCC
CAGCTCCGCTCAAAGCAGCAGCCGCCCTCATTTAGACCAACAACAACAAC
AGCAGCAGTAACAATAAAGTTGAGATTTAAAATGCAGGAAGAGCACAATG
CCCATTTCTTAAGTTCCAACTGATAAGTACACTAAAGATATCCAATATCT
GTCGTGCTGCCTCCCACGTTTGGCGGAATCGTGTGTCTCGCCTCCTGCAT
TTTGTACTGGAGAATTTGTTTGTAACCGCCTAAGCATAACACAGCATGAT
ATTGTCAACGGAACAGCCGCCTGCAGTCAGAAAATATTTATAAAAAATAA
AAGGTTTTCTATTAACAAAAAAAAAAAAAAA

RE32823.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ef1gamma-RA 1823 Ef1gamma-RA 105..1818 3..1715 8515 99.8 Plus
Ef1gamma-RB 1776 Ef1gamma-RB 116..1771 61..1715 8225 99.8 Plus
Ef1gamma.d 1689 Ef1gamma.d 30..1684 62..1715 8220 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25043400..25044867 249..1715 7140 99.3 Plus
chr3R 27901430 chr3R 25043189..25043340 101..252 760 100 Plus
chr3R 27901430 chr3R 25042970..25043067 3..100 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29220641..29222108 249..1715 7275 99.9 Plus
3R 32079331 3R 29220430..29220581 101..252 760 100 Plus
3R 32079331 3R 29220211..29220308 3..100 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28961472..28962939 249..1715 7285 99.8 Plus
3R 31820162 3R 28961261..28961412 101..252 760 100 Plus
3R 31820162 3R 28961042..28961139 3..100 490 100 Plus
Blast to na_te.dros performed 2019-03-16 13:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2374..2426 1414..1467 132 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6861 1401..1466 129 68.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6712..6751 1428..1467 128 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6681..6772 1380..1467 125 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6810 1414..1463 120 73.1 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3240..3312 1401..1468 119 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6793 1436..1467 115 84.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2366 1412..1467 114 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2772..2836 1401..1463 113 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5648..5675 1437..1464 113 89.3 Plus

RE32823.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:05:56 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25042968..25043067 1..100 99 -> Plus
chr3R 25043189..25043338 101..250 100 -> Plus
chr3R 25043402..25044827 251..1675 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:09:59 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1296 89..1384 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:43 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RC 1..1296 89..1384 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:49:11 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1296 89..1384 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:02:33 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1296 89..1384 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:03 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RB 1..1296 89..1384 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:33:37 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1716 2..1716 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:43 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1716 2..1716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:49:11 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1661 56..1716 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:02:34 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1716 2..1716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:03 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
Ef1gamma-RA 1..1661 56..1716 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:05:56 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29220643..29222108 251..1716 99   Plus
3R 29220209..29220308 1..100 99 -> Plus
3R 29220430..29220579 101..250 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:05:56 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29220643..29222108 251..1716 99   Plus
3R 29220209..29220308 1..100 99 -> Plus
3R 29220430..29220579 101..250 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:05:56 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29220643..29222108 251..1716 99   Plus
3R 29220209..29220308 1..100 99 -> Plus
3R 29220430..29220579 101..250 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:49:11 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25045931..25046030 1..100 99 -> Plus
arm_3R 25046152..25046301 101..250 100 -> Plus
arm_3R 25046365..25047830 251..1716 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:34:17 Download gff for RE32823.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28961474..28962939 251..1716 99   Plus
3R 28961040..28961139 1..100 99 -> Plus
3R 28961261..28961410 101..250 100 -> Plus

RE32823.hyp Sequence

Translation from 0 to 1383

> RE32823.hyp
CAPRFFAEFATISYLILYLQADDLNGESTMVKGTLYTYPENFRAYKALIA
AQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNA
IAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQ
QKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYV
LEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQ
AKTGAAKPQQQAQQQKQEKKPKEKKEAPKKAAEPAEELDAADEALAAEPK
SKDPFDALPKGTFNFDDFKRVYSNEDEAKSIPYFFDKFDAENYSIWFGEY
KYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWV
WRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDG
RKFNQGKIFK*

RE32823.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ef1gamma-PC 431 CG11901-PC 1..431 30..460 2255 100 Plus
Ef1gamma-PA 431 CG11901-PA 1..431 30..460 2255 100 Plus
Ef1gamma-PB 431 CG11901-PB 1..431 30..460 2255 100 Plus

RE32823.pep Sequence

Translation from 88 to 1383

> RE32823.pep
MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKF
PGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFA
DNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAG
ERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVV
KDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKKEAPK
KAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAK
SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKA
AFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAK
SEETKKLVTQYFSWSGTDKDGRKFNQGKIFK*

RE32823.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18406-PA 432 GF18406-PA 1..432 1..431 1977 91.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11656-PA 430 GG11656-PA 1..430 1..431 2220 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14004-PA 429 GH14004-PA 1..429 1..431 1834 80.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
eEF1gamma-PC 431 CG11901-PC 1..431 1..431 2255 100 Plus
eEF1gamma-PA 431 CG11901-PA 1..431 1..431 2255 100 Plus
eEF1gamma-PB 431 CG11901-PB 1..431 1..431 2255 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22348-PA 426 GI22348-PA 1..426 1..431 1808 83.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13604-PA 380 GL13604-PA 5..380 55..431 1622 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11269-PA 430 GA11269-PA 1..430 1..431 1883 87.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12777-PA 454 GM12777-PA 31..454 5..431 2197 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21427-PA 457 GD21427-PA 31..457 5..431 2232 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14227-PA 422 GJ14227-PA 1..422 1..431 1798 80.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12377-PA 333 GK12377-PA 10..333 84..431 1310 76.3 Plus
Dwil\GK22492-PA 264 GK22492-PA 1..210 1..210 956 88.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Ef1gamma-PA 431 GE23845-PA 1..431 1..431 2246 98.8 Plus