Clone RE33041 Report

Search the DGRC for RE33041

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:330
Well:41
Vector:pFlc-1
Associated Gene/TranscriptCpr23B-RA
Protein status:RE33041.pep: gold
Preliminary Size:909
Sequenced Size:1079

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2973 2001-12-14 Blastp of sequenced clone
CG2973 2002-01-01 Sim4 clustering to Release 2
CG2973 2003-01-01 Sim4 clustering to Release 3
Cpr23B 2008-04-29 Release 5.5 accounting
Cpr23B 2008-08-15 Release 5.9 accounting
Cpr23B 2008-12-18 5.12 accounting

Clone Sequence Records

RE33041.complete Sequence

1079 bp (1079 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071302

> RE33041.complete
ATTAGTTAGCTGACAATTTGTAGAGGCACTCCCACGAAAGGAAGATCCAA
ACGATTTGAGATGGCAGCTAAGTTTTTCGCCCTGCTGTCTCTGGCACTTT
TGGCCACTAGCCAAGCGGAGTACAACTACAACGAGAAGGAGGCGAAGGCG
GCCAACAGTGCGTCCAGTTCTGGCGAGGATTTCCTGAGCGACTACCACAC
GCCCAGCAACAATGCTCTGAACTCGGAGGCCACGCCCGATGGCTATGACT
ACGTGGCGCCCGCCAGGAATCAGTTCACCGCCGGCAGCCGTACGGCCAGT
GTTCAGGCCTCCAATCTTCTCCAGAATGCGGCCAGTGCCGCCAATGCCGA
ATCCGTGCTGCTGCCCTCGCCGCTGCCCGTTCTCCGCCACGAGCAGAACT
CGGAGGTGGTTTCATCGACGCAGCAGCAGCAGGAGCAGCAGACAGTTCAG
CATCAGCAGTCGGAACCGTTGGTGGTCAGCTCCGTTCTGCGCCAGCACCA
GGAGCCCGAGGTCTTTCCGCCCGCCAGCTACAGCTTCAACTATGCCGTGA
ACGACGCGAGCACCGGTGACATCAAGGAGCACAGCGAGACCCGGGATGGT
TATGTGGTGCGCGGATTCTACAGCCTGATCGATCCCGATGGCTACAAGCG
CACCGTGACCTACACGGCGGATGATGTGCATGGCTTCAATGCTGTGGTCA
ACCGGGTGCCCTATGCCCTTAAGGCGGTGGTTGTCCCTGTTGCCCAGGTG
GCGCAGCCCACTCCATTTGTGGCTCGCGATGAGCGCTCCAAGTCGGTGGA
TGTCATTCGATCGTCGGGAGCGGCAGCAGGTGCCTCAGAAAATGTCCTGT
CCGGTTCCGGCTCATCTTCGGGTTCCGTTTCCGGATCCGGCGTGAGCGAC
ACATTCGCTGAGGACAGCTACGCCAATGCTCCGCGAGGGCTGGACTCCTC
CGGCGGTCCCTACGCCTGAGTCCTGCTCGTGGCCTACGCACTCCTTGTAT
ATTCCTTCATTGTGCTTCATCTATTGCTAGTTTTTTAAAAAATAAATACA
AATTGTTCACCATAAAAAAAAAAAAAAAA

RE33041.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr23B-RA 1144 Cpr23B-RA 30..1093 1..1064 5320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2838235..2839227 71..1063 4920 99.7 Plus
chr2L 23010047 chr2L 2838101..2838172 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:50:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2838555..2839548 71..1064 4970 100 Plus
2L 23513712 2L 2838414..2838485 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2838555..2839548 71..1064 4970 100 Plus
2L 23513712 2L 2838414..2838485 1..72 360 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:10:54 has no hits.

RE33041.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:50 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2838101..2838172 1..72 100 -> Plus
chr2L 2838237..2839227 73..1063 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:10:05 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..909 61..969 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:39 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..909 61..969 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:00:00 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..909 61..969 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:49 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..909 61..969 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:02 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..909 61..969 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:35 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..1063 1..1063 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:38 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..1063 1..1063 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:00:00 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 4..1066 1..1063 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:49 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 1..1063 1..1063 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:02 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr23B-RA 4..1066 1..1063 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:50 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2838414..2838485 1..72 100 -> Plus
2L 2838557..2839547 73..1063 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:50 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2838414..2838485 1..72 100 -> Plus
2L 2838557..2839547 73..1063 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:50 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2838414..2838485 1..72 100 -> Plus
2L 2838557..2839547 73..1063 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:00:00 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2838414..2838485 1..72 100 -> Plus
arm_2L 2838557..2839547 73..1063 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:04 Download gff for RE33041.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2838557..2839547 73..1063 100   Plus
2L 2838414..2838485 1..72 100 -> Plus

RE33041.pep Sequence

Translation from 60 to 968

> RE33041.pep
MAAKFFALLSLALLATSQAEYNYNEKEAKAANSASSSGEDFLSDYHTPSN
NALNSEATPDGYDYVAPARNQFTAGSRTASVQASNLLQNAASAANAESVL
LPSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPE
VFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVT
YTADDVHGFNAVVNRVPYALKAVVVPVAQVAQPTPFVARDERSKSVDVIR
SSGAAAGASENVLSGSGSSSGSVSGSGVSDTFAEDSYANAPRGLDSSGGP
YA*

RE33041.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14983-PA 273 GF14983-PA 1..273 1..302 879 65.7 Plus
Dana\GF17801-PA 217 GF17801-PA 44..127 150..233 227 58.3 Plus
Dana\GF17184-PA 186 GF17184-PA 37..117 157..236 223 58 Plus
Dana\GF15740-PA 356 GF15740-PA 124..203 134..215 217 54.9 Plus
Dana\GF23877-PA 204 GF23877-PA 53..131 138..215 215 55.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24889-PA 313 GG24889-PA 1..313 1..302 1061 82.5 Plus
Dere\GG13610-PA 183 GG13610-PA 37..116 157..236 230 61.3 Plus
Dere\GG10302-PA 211 GG10302-PA 44..111 150..217 220 64.7 Plus
Dere\GG15930-PA 245 GG15930-PA 42..129 136..222 211 53.4 Plus
Dere\GG14206-PA 148 GG14206-PA 63..143 150..228 207 56.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25078-PA 551 GH25078-PA 418..551 147..302 369 55.3 Plus
Dgri\GH19488-PA 195 GH19488-PA 42..109 150..217 225 63.2 Plus
Dgri\GH15052-PA 136 GH15052-PA 36..110 139..215 213 55.8 Plus
Dgri\GH18129-PA 227 GH18129-PA 53..117 153..217 212 66.2 Plus
Dgri\GH15546-PA 200 GH15546-PA 61..145 149..237 209 52.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr23B-PA 302 CG2973-PA 1..302 1..302 1516 100 Plus
Cpr31A-PA 340 CG33302-PA 1..214 1..235 242 32.9 Plus
Ccp84Ae-PA 208 CG1330-PA 44..127 150..233 237 57.1 Plus
Ccp84Ab-PA 221 CG1252-PA 41..146 136..233 236 50.9 Plus
Cpr64Aa-PA 192 CG15006-PA 51..139 149..237 233 55.6 Plus
Edg84A-PA 188 CG2345-PA 37..114 157..233 231 62.8 Plus
Ccp84Aa-PA 205 CG2360-PA 41..146 136..233 230 50 Plus
Cpr92A-PA 245 CG6240-PA 43..145 133..235 227 50 Plus
CG34461-PB 138 CG34461-PB 33..126 136..231 223 49 Plus
CG34461-PA 138 CG34461-PA 33..126 136..231 223 49 Plus
Ccp84Ad-PA 199 CG2341-PA 55..144 150..238 222 54.4 Plus
Cpr5C-PA 145 CG4052-PA 46..137 138..231 220 55.3 Plus
Ccp84Ag-PA 191 CG2342-PA 32..122 147..237 220 50.5 Plus
Ccp84Af-PA 151 CG1331-PA 55..144 150..235 218 54.4 Plus
Cpr62Bb-PC 194 CG13935-PC 19..119 141..241 216 44.6 Plus
Cpr62Bb-PB 194 CG13935-PB 19..119 141..241 216 44.6 Plus
Cpr62Bb-PA 194 CG13935-PA 19..119 141..241 216 44.6 Plus
Cpr30F-PA 146 CG31876-PA 38..124 150..235 214 50.6 Plus
Cpr64Ab-PA 120 CG15007-PA 35..115 150..228 213 56.8 Plus
Ccp84Ac-PA 217 CG1327-PA 21..127 105..219 212 43.2 Plus
Cpr66Cb-PA 162 CG7076-PA 39..147 104..215 207 41.6 Plus
Cpr64Ad-PB 247 CG1259-PB 146..239 157..239 203 50 Plus
CG42367-PC 103 CG42367-PC 20..99 138..217 199 46.2 Plus
Cpr62Bc-PB 180 CG1919-PB 54..129 157..228 199 55.3 Plus
Cpr62Bc-PA 180 CG1919-PA 54..129 157..228 199 55.3 Plus
Crys-PB 477 CG16963-PB 35..135 118..215 197 43.6 Plus
Crys-PA 477 CG16963-PA 35..135 118..215 197 43.6 Plus
Cpr64Ac-PA 188 CG15008-PA 88..166 153..231 187 51.9 Plus
Cpr76Ba-PA 204 CG9283-PA 69..162 127..219 185 44.8 Plus
Cpr30B-PA 153 CG3818-PA 25..97 148..221 184 50 Plus
Cpr76Bb-PA 198 CG9290-PA 79..148 148..219 181 54.2 Plus
Cpr35B-PA 218 CG3474-PA 70..130 155..215 179 57.4 Plus
Cpr76Bc-PD 424 CG9295-PD 56..115 157..216 171 55 Plus
Cpr76Bc-PC 424 CG9295-PC 56..115 157..216 171 55 Plus
Cpr76Bd-PD 1228 CG9299-PD 1153..1209 157..213 163 59.6 Plus
Cpr76Bd-PB 1228 CG9299-PB 1153..1209 157..213 163 59.6 Plus
Cpr76Bd-PC 1231 CG9299-PC 1156..1212 157..213 163 59.6 Plus
CG13670-PA 266 CG13670-PA 103..159 157..213 157 54.4 Plus
Cpr66D-PA 270 CG32029-PA 113..232 103..234 154 35.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17444-PA 253 GI17444-PA 58..253 33..302 419 41.9 Plus
Dmoj\GI17588-PA 331 GI17588-PA 119..189 157..228 219 62.5 Plus
Dmoj\GI23758-PA 189 GI23758-PA 42..109 150..217 218 63.2 Plus
Dmoj\GI24313-PA 146 GI24313-PA 40..127 150..236 217 51.1 Plus
Dmoj\GI23759-PA 145 GI23759-PA 49..139 142..236 212 54.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15446-PA 260 GL15446-PA 1..260 1..302 770 61.2 Plus
Dper\GL22051-PA 217 GL22051-PA 45..112 150..217 218 63.2 Plus
Dper\GL21772-PA 223 GL21772-PA 34..130 150..238 217 52.6 Plus
Dper\GL19198-PA 146 GL19198-PA 40..127 150..236 214 52.3 Plus
Dper\GL24692-PA 133 GL24692-PA 40..107 146..215 212 60 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15548-PA 260 GA15548-PA 1..260 1..302 788 62.8 Plus
Dpse\GA12183-PB 217 GA12183-PB 45..112 150..217 218 63.2 Plus
Dpse\GA27359-PA 211 GA27359-PA 56..120 153..217 216 67.7 Plus
Dpse\GA16543-PA 146 GA16543-PA 40..127 150..236 214 52.3 Plus
Dpse\GA23954-PA 133 GA23954-PA 40..107 146..215 212 60 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18369-PA 165 GM18369-PA 4..165 145..302 581 88.3 Plus
Dsec\GM10909-PA 188 GM10909-PA 37..105 157..225 232 68.1 Plus
Dsec\GM10534-PA 208 GM10534-PA 44..127 150..233 223 59.3 Plus
Dsec\GM26903-PA 245 GM26903-PA 43..133 133..222 215 52.7 Plus
Dsec\GM12439-PA 145 GM12439-PA 60..137 153..231 208 59.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23185-PA 310 GD23185-PA 1..310 1..302 1086 91 Plus
Dsim\GD19888-PA 188 GD19888-PA 37..105 157..225 231 68.1 Plus
Dsim\GD19526-PA 236 GD19526-PA 58..140 153..234 216 59 Plus
Dsim\GD14078-PA 177 GD14078-PA 72..149 136..215 215 53.8 Plus
Dsim\GD19530-PA 205 GD19530-PA 44..111 150..217 215 63.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14252-PA 251 GJ14252-PA 56..251 34..302 445 43.1 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 42..151 150..258 231 51.8 Plus
Dvir\GJ23938-PA 233 GJ23938-PA 53..117 153..217 220 67.7 Plus
Dvir\GJ21574-PA 146 GJ21574-PA 40..127 150..236 213 51.1 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 42..109 146..215 212 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24278-PA 286 GK24278-PA 1..286 1..302 649 54.4 Plus
Dwil\GK11910-PA 389 GK11910-PA 32..109 136..215 222 55 Plus
Dwil\GK10832-PA 179 GK10832-PA 51..132 153..233 220 61 Plus
Dwil\GK12249-PA 228 GK12249-PA 51..132 153..233 220 61 Plus
Dwil\GK24776-PA 148 GK24776-PA 40..121 150..230 204 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18183-PA 326 GE18183-PA 1..326 1..302 1054 81.6 Plus
Dyak\GE25837-PA 202 GE25837-PA 44..127 150..233 230 57.1 Plus
Dyak\GE24878-PA 188 GE24878-PA 37..105 157..225 212 63.8 Plus
Dyak\GE25836-PA 219 GE25836-PA 21..127 105..219 211 45.8 Plus
Dyak\GE20635-PA 120 GE20635-PA 35..115 150..228 206 56.8 Plus

RE33041.hyp Sequence

Translation from 60 to 968

> RE33041.hyp
MAAKFFALLSLALLATSQAEYNYNEKEAKAANSASSSGEDFLSDYHTPSN
NALNSEATPDGYDYVAPARNQFTAGSRTASVQASNLLQNAASAANAESVL
LPSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPE
VFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVT
YTADDVHGFNAVVNRVPYALKAVVVPVAQVAQPTPFVARDERSKSVDVIR
SSGAAAGASENVLSGSGSSSGSVSGSGVSDTFAEDSYANAPRGLDSSGGP
YA*

RE33041.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr23B-PA 302 CG2973-PA 1..302 1..302 1516 100 Plus
Cpr31A-PA 340 CG33302-PA 1..214 1..235 242 32.9 Plus
Ccp84Ae-PA 208 CG1330-PA 44..127 150..233 237 57.1 Plus
Ccp84Ab-PA 221 CG1252-PA 41..146 136..233 236 50.9 Plus
Cpr64Aa-PA 192 CG15006-PA 51..139 149..237 233 55.6 Plus