Clone RE33114 Report

Search the DGRC for RE33114

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:331
Well:14
Vector:pFlc-1
Associated Gene/TranscriptRpL5-RA
Protein status:RE33114.pep: gold
Sequenced Size:1077

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17489 2001-12-14 Blastp of sequenced clone
CG17489 2002-01-01 Sim4 clustering to Release 2
CG17489 2003-01-01 Sim4 clustering to Release 3
RpL5 2008-04-29 Release 5.5 accounting
RpL5 2008-08-15 Release 5.9 accounting
RpL5 2008-12-18 5.12 accounting

Clone Sequence Records

RE33114.complete Sequence

1077 bp (1077 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071305

> RE33114.complete
ACGTTTGTTTCTTGGATCCAATAAGGCCGCACTATTTTCCTTCTTTTTGC
TAGCAATTTCCGGCGAGCGGTTATATTGTTATCAAATTTTAAAATGGGTT
TCGTTAAGGTAGTCAAGAACAAGCAGTACTTTAAGAGGTACCAAGTCAAG
TTCCGAAGGCGTCGCGAAGGAAAGACCGATTACTATGCCAGGAAACGCCT
AACATTTCAGGACAAGAACAAGTACAACACTCCCAAGTACCGTTTGATCG
TACGTTTGTCCAACAAGGACATCACAGTACAGATCGCCTATGCTCGCATC
GAGGGTGATCGCGTGGTGTGCGCTGCTTATTCCCATGAGCTTCCCAAATA
CGGGATCCAGGTTGGATTGACCAACTACGCTGCTGCTTACTGCACAGGCC
TGCTGGTCGCCCGTCGTGTCCTTAACAAGTTGGGACTGGACTCCCTATAT
GCAGGATGCACTGAAGTGACTGGTGAGGAGTTCAACGTCGAGCCTGTTGA
TGACGGCCCAGGGGCATTCCGTTGCTTCTTGGATGTTGGACTCGCTCGTA
CTACAACTGGTGCCCGTGTGTTTGGCGCTATGAAGGGAGCAGTTGATGGT
GGTCTAAACATACCTCACTCTGTGAAACGCTTTCCTGGATACTCTGCTGA
AACCAAGAGCTTTAATGCCGATGTGCATCGCGCTCATATATTTGGCCAGC
ACGTTGCAGACTATATGCGTTCTTTGGAGGAGGAGGATGAGGAGAGCTTC
AAAAGGCAGTTTAGCCGATACATCAAGTTGGGCATTCGTGCTGATGATCT
TGAGGATATCTATAAAAAAGCCCACCAGGCAATTCGTAACGACCCTACAC
ACAAGGTCACCGCTAAGAAGTCTTCTGCCGTTACGAAGAAAAGGTGGAAT
GCTAAGAAACTCACAAACGAGCAACGGAAGACTAAGATTGCAGCTCATAA
GGCAGCATATGTTGCCAAGCTGCAGTCTGAAACTGAGGCTTAAAAGTGTT
CGTCACCAGCTTCAGTTTATATTGGTGTAAAAATAAATAAACAGTTCTAA
TGACACCAAAGAAAAAAAAAAAAAAAA

RE33114.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpL5-RB 1411 RpL5-RB 4..1058 4..1058 5275 100 Plus
RpL5-RA 1479 RpL5-RA 134..1126 66..1058 4965 100 Plus
RpL5.b 1757 RpL5.b 98..1090 66..1058 4965 100 Plus
RpL5-RA 1479 RpL5-RA 17..80 4..67 320 100 Plus
RpL5.b 1757 RpL5.b 1..44 24..67 220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22426858..22427297 798..359 2200 100 Minus
chr2L 23010047 chr2L 22427354..22427620 362..96 1335 100 Minus
chr2L 23010047 chr2L 22426045..22426304 1058..799 1300 100 Minus
chr2L 23010047 chr2L 22427862..22427925 67..4 320 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:50:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22535617..22536056 798..359 2200 100 Minus
2L 23513712 2L 22536113..22536379 362..96 1335 100 Minus
2L 23513712 2L 22534804..22535063 1058..799 1300 100 Minus
2L 23513712 2L 22536621..22536684 67..4 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22535617..22536056 798..359 2200 100 Minus
2L 23513712 2L 22536113..22536379 362..96 1335 100 Minus
2L 23513712 2L 22534804..22535063 1058..799 1300 100 Minus
2L 23513712 2L 22536621..22536684 67..4 320 100 Minus
2L 23513712 2L 22536536..22536567 97..66 160 100 Minus
Blast to na_te.dros performed 2019-03-16 01:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 2982..3090 1018..908 117 63.5 Minus

RE33114.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:56:38 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22426042..22426304 799..1061 99 <- Minus
chr2L 22426858..22427295 361..798 100 <- Minus
chr2L 22427356..22427619 97..360 100 <- Minus
chr2L 22427778..22427806 68..96 100 <- Minus
chr2L 22427862..22427928 1..67 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:10:09 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..900 94..993 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:15 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..900 94..993 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:51 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RA 1..900 94..993 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:30 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..900 94..993 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:51:31 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..900 94..993 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:33 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..1059 1..1061 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:15 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..1059 1..1061 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:51 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RG 1..1059 1..1061 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:30 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RB 1..1059 1..1061 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:51:31 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
RpL5-RG 1..1059 1..1061 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:38 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22534801..22535063 799..1061 99 <- Minus
2L 22535617..22536054 361..798 100 <- Minus
2L 22536115..22536378 97..360 100 <- Minus
2L 22536537..22536565 68..96 100 <- Minus
2L 22536621..22536687 1..67 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:38 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22534801..22535063 799..1061 99 <- Minus
2L 22535617..22536054 361..798 100 <- Minus
2L 22536115..22536378 97..360 100 <- Minus
2L 22536537..22536565 68..96 100 <- Minus
2L 22536621..22536687 1..67 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:38 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22534801..22535063 799..1061 99 <- Minus
2L 22535617..22536054 361..798 100 <- Minus
2L 22536115..22536378 97..360 100 <- Minus
2L 22536537..22536565 68..96 100 <- Minus
2L 22536621..22536687 1..67 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:51 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22427533..22427795 799..1061 99 <- Minus
arm_2L 22428349..22428786 361..798 100 <- Minus
arm_2L 22428847..22429110 97..360 100 <- Minus
arm_2L 22429269..22429297 68..96 100 <- Minus
arm_2L 22429353..22429419 1..67 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:33 Download gff for RE33114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22534801..22535063 799..1061 99 <- Minus
2L 22535617..22536054 361..798 100 <- Minus
2L 22536115..22536378 97..360 100 <- Minus
2L 22536537..22536565 68..96 100 <- Minus
2L 22536621..22536687 1..67 98   Minus

RE33114.pep Sequence

Translation from 93 to 992

> RE33114.pep
MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYR
LIVRLSNKDITVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYC
TGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGL
ARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVHRAHIF
GQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRND
PTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA*

RE33114.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22760-PA 308 GF22760-PA 11..308 2..299 1574 98.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21448-PA 299 GG21448-PA 2..299 2..299 1590 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13292-PA 858 GH13292-PA 560..858 1..299 1467 92.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
RpL5-PG 299 CG17489-PG 1..299 1..299 1553 100 Plus
RpL5-PH 299 CG17489-PH 1..299 1..299 1553 100 Plus
RpL5-PB 299 CG17489-PB 1..299 1..299 1553 100 Plus
RpL5-PA 299 CG17489-PA 1..299 1..299 1553 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17484-PA 756 GI17484-PA 460..756 2..299 1448 93.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21177-PA 299 GL21177-PA 1..299 1..299 1575 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28757-PA 299 GA28757-PA 1..299 1..299 1575 98.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26730-PA 318 GM26730-PA 21..318 2..299 1593 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15046-PA 992 GJ15046-PA 694..992 1..299 1494 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24660-PA 299 GK24660-PA 1..299 1..299 1565 97 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\yip6-PA 299 GE15279-PA 1..299 1..299 1598 100 Plus

RE33114.hyp Sequence

Translation from 93 to 992

> RE33114.hyp
MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYR
LIVRLSNKDITVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYC
TGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGL
ARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVHRAHIF
GQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRND
PTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA*

RE33114.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpL5-PG 299 CG17489-PG 1..299 1..299 1553 100 Plus
RpL5-PH 299 CG17489-PH 1..299 1..299 1553 100 Plus
RpL5-PB 299 CG17489-PB 1..299 1..299 1553 100 Plus
RpL5-PA 299 CG17489-PA 1..299 1..299 1553 100 Plus