Clone RE33457 Report

Search the DGRC for RE33457

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:334
Well:57
Vector:pFlc-1
Associated Gene/TranscriptCG8629-RA
Protein status:RE33457.pep: gold
Preliminary Size:255
Sequenced Size:365

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8629 2001-12-14 Blastp of sequenced clone
CG8629 2002-01-01 Sim4 clustering to Release 2
CG8629 2003-01-01 Sim4 clustering to Release 3
CG8629 2008-04-29 Release 5.5 accounting
CG8629 2008-08-15 Release 5.9 accounting
CG8629 2008-12-18 5.12 accounting

Clone Sequence Records

RE33457.complete Sequence

365 bp (365 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071308

> RE33457.complete
GGACTTAGTATCTTTTACAAACTTATGACAAAATGGTCAGTTTTGAGGAA
GCCGCCGAACTCGCCAAGAACTTCTCCAAGAAGCCCACCGACTCCGAGTT
CCTGGAGTTCTACGGTCTCTTCAAGCAGGCTACCGTTGGTGATGTGAACA
TCGACAAGCCCGGCATTCTGGATCTCAAGAAGAAGGCCATGTACGAGGCC
TGGAACGCCCACAAGGGTCTCTCCAAGGATGCCGCCAAGGAGGCCTACGT
GAAGGTGTACGAGAAGTATGCCCCCAAGTACGCCTAAGGCCAGACTATTC
TCCAGACTGTTCTCTATCTGACAAATAAACTCGAAATCTTATTATGAGTA
AAAAAAAAAAAAAAA

RE33457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-RA 348 CG8629-RA 2..346 3..347 1725 100 Plus
CG8628-RA 682 CG8628-RA 108..351 45..288 830 89.3 Plus
CG8628-RB 705 CG8628-RB 113..356 45..288 830 89.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7120183..7120527 347..3 1710 99.7 Minus
chr3L 24539361 chr3L 7123406..7123649 45..288 845 89.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:50:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7127915..7128259 347..3 1725 100 Minus
3L 28110227 3L 7131147..7131390 45..288 830 89.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7121015..7121359 347..3 1725 100 Minus
3L 28103327 3L 7124247..7124490 45..288 830 89.3 Plus
Blast to na_te.dros performed on 2019-03-15 16:25:45 has no hits.

RE33457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:26:52 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7120181..7120527 1..349 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:10:25 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 1..255 33..287 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:40 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 1..255 33..287 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:02:06 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 1..255 33..287 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:15 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 1..255 33..287 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:24 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 1..255 33..287 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:09 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 2..348 3..349 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:40 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 2..348 3..349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:06 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 4..352 1..349 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:16 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 2..348 3..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:24 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 4..352 1..349 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:26:52 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7127913..7128259 1..349 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:26:52 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7127913..7128259 1..349 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:26:52 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7127913..7128259 1..349 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:06 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7121013..7121359 1..349 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:14 Download gff for RE33457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7121013..7121359 1..349 99   Minus

RE33457.pep Sequence

Translation from 32 to 286

> RE33457.pep
MVSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKK
KAMYEAWNAHKGLSKDAAKEAYVKVYEKYAPKYA*

RE33457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24791-PA 84 GF24791-PA 1..84 1..84 397 90.5 Plus
Dana\GF25010-PA 84 GF25010-PA 1..84 1..84 367 86.9 Plus
Dana\GF25009-PA 82 GF25009-PA 1..81 1..83 228 57.8 Plus
Dana\GF25011-PA 85 GF25011-PA 5..85 4..84 220 54.3 Plus
Dana\GF14408-PA 88 GF14408-PA 5..74 4..73 214 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14997-PA 84 GG14997-PA 1..84 1..84 412 96.4 Plus
Dere\GG14405-PA 84 GG14405-PA 1..84 1..84 367 85.7 Plus
Dere\GG14406-PA 86 GG14406-PA 1..86 1..84 224 53.5 Plus
Dere\GG14404-PA 82 GG14404-PA 1..81 1..83 222 55.4 Plus
Dere\GG23473-PA 90 GG23473-PA 7..76 4..73 209 55.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17042-PA 84 GH17042-PA 1..84 1..84 399 89.3 Plus
Dgri\GH16140-PA 84 GH16140-PA 1..84 1..84 318 72.6 Plus
Dgri\GH14518-PA 87 GH14518-PA 6..87 3..84 228 56.1 Plus
Dgri\GH14516-PA 82 GH14516-PA 1..81 1..83 221 54.2 Plus
Dgri\GH11506-PA 90 GH11506-PA 7..76 4..73 215 57.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp4-PA 84 CG8629-PA 1..84 1..84 435 100 Plus
Acbp3-PA 84 CG8628-PA 1..84 1..84 366 83.3 Plus
Acbp3-PB 84 CG8628-PB 1..84 1..84 366 83.3 Plus
Acbp6-PB 82 CG15829-PB 1..81 1..83 240 56.6 Plus
Acbp6-PA 82 CG15829-PA 1..81 1..83 240 56.6 Plus
Acbp2-PA 86 CG8627-PA 6..86 4..84 225 53.1 Plus
Acbp2-PB 86 CG8627-PB 6..86 4..84 225 53.1 Plus
Acbp5-PA 82 CG5804-PA 1..81 1..83 211 53 Plus
Acbp1-PB 90 CG8498-PB 7..76 4..73 206 55.7 Plus
Acbp1-PA 90 CG8498-PA 7..76 4..73 206 55.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13295-PA 87 GI13295-PA 7..87 4..84 219 54.3 Plus
Dmoj\GI17002-PA 90 GI17002-PA 7..76 4..73 208 55.7 Plus
Dmoj\GI13294-PA 82 GI13294-PA 1..81 1..83 171 48.2 Plus
Dmoj\GI11160-PA 322 GI11160-PA 18..82 10..74 145 43.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25142-PA 84 GL25142-PA 1..84 1..84 396 89.3 Plus
Dper\GL25027-PA 84 GL25027-PA 1..84 1..84 388 88.1 Plus
Dper\GL25029-PA 87 GL25029-PA 7..87 4..84 238 58 Plus
Dper\GL19321-PA 90 GL19321-PA 7..76 4..73 220 58.6 Plus
Dper\GL25026-PA 82 GL25026-PA 1..78 1..80 206 53.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21220-PA 84 GA21220-PA 1..84 1..84 396 89.3 Plus
Dpse\GA23591-PA 84 GA23591-PA 1..84 1..84 388 88.1 Plus
Dpse\GA21218-PA 87 GA21218-PA 7..87 4..84 236 58 Plus
Dpse\GA21120-PA 90 GA21120-PA 7..76 4..73 218 58.6 Plus
Dpse\GA13977-PA 82 GA13977-PA 1..78 1..80 206 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13788-PA 84 GM13788-PA 1..84 1..84 426 100 Plus
Dsec\GM14821-PA 84 GM14821-PA 1..84 1..84 359 84.5 Plus
Dsec\GM14822-PA 86 GM14822-PA 1..86 1..84 231 55.8 Plus
Dsec\GM14820-PA 82 GM14820-PA 1..81 1..83 222 55.4 Plus
Dsec\GM13159-PA 90 GM13159-PA 7..76 4..73 211 55.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13089-PA 84 GD13089-PA 1..84 1..84 426 100 Plus
Dsim\GD13994-PA 84 GD13994-PA 1..84 1..84 359 84.5 Plus
Dsim\GD13995-PA 86 GD13995-PA 1..86 1..84 226 54.7 Plus
Dsim\GD13993-PA 82 GD13993-PA 1..81 1..83 222 55.4 Plus
Dsim\GD22437-PA 90 GD22437-PA 7..76 4..73 211 55.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13316-PA 84 GJ13316-PA 1..84 1..84 403 90.5 Plus
Dvir\GJ12299-PA 83 GJ12299-PA 1..83 2..84 294 69.9 Plus
Dvir\GJ12298-PA 81 GJ12298-PA 1..80 2..83 214 52.4 Plus
Dvir\GJ12060-PA 82 GJ12060-PA 1..81 1..83 213 55.4 Plus
Dvir\GJ12061-PA 87 GJ12061-PA 7..87 4..84 212 53.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17538-PA 84 GK17538-PA 1..84 1..84 408 91.7 Plus
Dwil\GK19286-PA 81 GK19286-PA 1..81 4..84 290 69.1 Plus
Dwil\GK16653-PA 87 GK16653-PA 6..87 3..84 239 57.3 Plus
Dwil\GK23743-PA 90 GK23743-PA 4..76 1..73 224 57.5 Plus
Dwil\GK19285-PA 79 GK19285-PA 1..79 4..84 218 58 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20443-PA 84 GE20443-PA 1..84 1..84 403 94 Plus
Dyak\GE21595-PA 84 GE21595-PA 1..84 1..84 362 84.5 Plus
Dyak\GE21596-PA 86 GE21596-PA 1..86 1..84 229 54.7 Plus
Dyak\GE21594-PA 82 GE21594-PA 1..81 1..83 220 56.6 Plus
Dyak\GE11169-PA 90 GE11169-PA 7..76 4..73 211 57.1 Plus

RE33457.hyp Sequence

Translation from 32 to 286

> RE33457.hyp
MVSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKK
KAMYEAWNAHKGLSKDAAKEAYVKVYEKYAPKYA*

RE33457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-PA 84 CG8629-PA 1..84 1..84 435 100 Plus
CG8628-PA 84 CG8628-PA 1..84 1..84 366 83.3 Plus
CG8628-PB 84 CG8628-PB 1..84 1..84 366 83.3 Plus
CG15829-PB 82 CG15829-PB 1..81 1..83 240 56.6 Plus
CG15829-PA 82 CG15829-PA 1..81 1..83 240 56.6 Plus