Clone RE34039 Report

Search the DGRC for RE34039

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:340
Well:39
Vector:pFlc-1
Associated Gene/TranscriptCG9586-RB
Protein status:RE34039.pep: gold
Preliminary Size:944
Sequenced Size:966

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9586 2001-12-14 Blastp of sequenced clone
CG9586 2002-01-01 Sim4 clustering to Release 2
CG9586 2003-01-01 Sim4 clustering to Release 3
CG9586 2008-04-29 Release 5.5 accounting
CG9586 2008-08-15 Release 5.9 accounting
CG9586 2008-12-18 5.12 accounting

Clone Sequence Records

RE34039.complete Sequence

966 bp (966 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071317

> RE34039.complete
GCTCGCCAACACTGCGCCACATGCTCCACAAATTTTTTTGTTGCCTTTTG
CGGCTGATTTGTCACTGCCAGAGTTTATTCCGCAAATAAAATCCTCTATA
CATGATATTTAAATCAAATACCGAGTAACCATGAGCGCCACGGATGACTT
CCAGAGCTGGCTCAACGAGCAGCTGCGCAAATTGAACACCGACGAGAACG
TTTTCGGTTCGTATATTATTGGAATTTTGGAGGGCGACGAAACGACAGAT
GAAAAAACCGAGGCTCTCGAGGGAATTCTCAGCGAAACAGGTTCCGCCAA
CATTGACGAACTGGTGGCCACCATACTACAAAAGTGGCTACAGAGCCATC
CCAGCGCCGATGATCCGCCGAAAAAAGGTCTGGATATCGATGTGAATGCC
CAGTTGGCCAAGTTGCTGGAGCAACAGAAGCTGCAACCCGCCGTAAACAA
GGAGCGTGAATACACCGAAGAGGAGCGTCGCATCAAGCAGCAGATTCTAG
CTCAATACTCCCAGACTGCCGTTGCCAACGAGGACGACGAGAATTCCGAG
GCGGAAAGCGAGGATGACAGTGGAACGCTCACCAAGAATACCAACAAATC
GGATGTCCAGGCGCTAGCCAAGGAAAAGCGGGAGCAGGCCCGAATGGATA
GTGCGGCCAAAAAGCAAAAGGACAAAGAGGATCGGGAAAAGCAAAAGCAA
CTGCGCGAGGAAAAGAAGGAGAAACGCAAAACCGTCAAAGGCGAACGGCG
TCGATAACCGTCCCCAAGCGAATATTTTTAGACTCTTTCTATTAAAAACA
ACAAACAACAAATCTGTACAAAGTGCATTTCGCTTGAATGTTTGCATGTT
TGCCTAAAGCGAAGTAAACTTTGAAGAGATCTACCGAACTGTTGAATATA
AATGTATTAAAATTGAAACGCCAAGATTTTAATTTGAAAAAAAAAAAAAA
GAAAAAAAAAAAAAAA

RE34039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9586-RB 1019 CG9586-RB 41..977 1..937 4670 99.8 Plus
CG9586.a 995 CG9586.a 30..543 1..514 2555 99.8 Plus
CG9586.a 995 CG9586.a 571..995 512..936 2125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9164328..9164745 937..512 1960 97.9 Minus
chr2L 23010047 chr2L 9165123..9165414 292..1 1445 99.7 Minus
chr2L 23010047 chr2L 9164843..9165064 514..293 1110 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:50:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9165420..9165845 937..512 2130 100 Minus
2L 23513712 2L 9166223..9166514 292..1 1445 99.7 Minus
2L 23513712 2L 9165943..9166164 514..293 1110 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9165420..9165845 937..512 2130 100 Minus
2L 23513712 2L 9166223..9166514 292..1 1445 99.6 Minus
2L 23513712 2L 9165943..9166164 514..293 1110 100 Minus
Blast to na_te.dros performed 2019-03-15 14:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 754..888 950..818 110 57.4 Minus

RE34039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:12:30 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9164329..9164742 515..936 97 <- Minus
chr2L 9164843..9165064 293..514 100 <- Minus
chr2L 9165123..9165414 1..292 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:10:55 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..627 131..757 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:43 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..627 131..757 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:22:21 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..627 131..757 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:18 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..627 131..757 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:53:38 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..627 131..757 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:13 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..867 70..936 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:43 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 30..965 1..936 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:22:21 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..936 1..936 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:18 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..867 70..936 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:53:38 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
CG9586-RB 1..936 1..936 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:12:30 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9165421..9165842 515..936 100 <- Minus
2L 9165943..9166164 293..514 100 <- Minus
2L 9166223..9166514 1..292 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:12:30 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9165421..9165842 515..936 100 <- Minus
2L 9165943..9166164 293..514 100 <- Minus
2L 9166223..9166514 1..292 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:12:30 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9165421..9165842 515..936 100 <- Minus
2L 9165943..9166164 293..514 100 <- Minus
2L 9166223..9166514 1..292 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:22:21 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9165421..9165842 515..936 100 <- Minus
arm_2L 9165943..9166164 293..514 100 <- Minus
arm_2L 9166223..9166514 1..292 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:17 Download gff for RE34039.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9165421..9165842 515..936 100 <- Minus
2L 9165943..9166164 293..514 100 <- Minus
2L 9166223..9166514 1..292 99   Minus

RE34039.hyp Sequence

Translation from 130 to 756

> RE34039.hyp
MSATDDFQSWLNEQLRKLNTDENVFGSYIIGILEGDETTDEKTEALEGIL
SETGSANIDELVATILQKWLQSHPSADDPPKKGLDIDVNAQLAKLLEQQK
LQPAVNKEREYTEEERRIKQQILAQYSQTAVANEDDENSEAESEDDSGTL
TKNTNKSDVQALAKEKREQARMDSAAKKQKDKEDREKQKQLREEKKEKRK
TVKGERRR*

RE34039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG9586-PB 208 CG9586-PB 1..208 1..208 1043 100 Plus
CG9586-PC 218 CG9586-PC 1..218 1..208 1022 95.4 Plus

RE34039.pep Sequence

Translation from 130 to 756

> RE34039.pep
MSATDDFQSWLNEQLRKLNTDENVFGSYIIGILEGDETTDEKTEALEGIL
SETGSANIDELVATILQKWLQSHPSADDPPKKGLDIDVNAQLAKLLEQQK
LQPAVNKEREYTEEERRIKQQILAQYSQTAVANEDDENSEAESEDDSGTL
TKNTNKSDVQALAKEKREQARMDSAAKKQKDKEDREKQKQLREEKKEKRK
TVKGERRR*

RE34039.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22060-PA 208 GF22060-PA 1..208 1..208 874 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24037-PA 208 GG24037-PA 1..208 1..208 878 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13644-PA 206 GH13644-PA 3..206 6..208 787 78.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9586-PB 208 CG9586-PB 1..208 1..208 1043 100 Plus
CG9586-PC 218 CG9586-PC 1..218 1..208 1022 95.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11923-PA 207 GI11923-PA 3..207 6..208 830 81.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25537-PA 208 GL25537-PA 1..208 1..208 826 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21893-PA 208 GA21893-PA 1..208 1..208 826 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12539-PA 208 GM12539-PA 1..208 1..208 1032 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22364-PA 208 GD22364-PA 1..208 1..208 1041 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14035-PA 207 GJ14035-PA 3..207 6..208 824 80.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15064-PA 210 GK15064-PA 1..210 1..208 818 82.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10599-PA 208 GE10599-PA 1..208 1..208 883 94.2 Plus